KEGG   Ornithorhynchus anatinus (platypus): 100093026Help
Entry
100093026         CDS       T01045                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like
Organism
oaa  Ornithorhynchus anatinus (platypus)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 240 aa AA seqDB search
MGQGDGRNQLGGSSDFPEHIPPNPPWGKARETSGLGSRGEGVCSDKAHASELTLSLTPEH
GELNPGYFQGSQRNVIGLLDVFTPDDTLDDFNDFYLVMPFMGTDLGKIMKHEKLSEDRIQ
FLVYQMLKGLKYIHDAGIIHRDLKPGNLAVNEDCELKILDFGLARQTDSEMTGYVVTRWY
RAPEVILNWMHYTQTVDIWSVGCIMAEMITGKILFKGNDRILRAAEVGVGAVPGTDRGGP
NT seq 721 nt NT seq  +upstreamnt  +downstreamnt
atgggccagggcgatgggagaaatcagctcggaggctccagtgactttcctgaacacatt
ccccccaacccaccctggggcaaggccagggaaacttccggcctggggagtcggggcgag
ggggtttgcagcgacaaggctcatgcaagcgaattgactctttctctcacacctgagcac
ggggagttgaatccaggctacttccagggaagccaaagaaacgtcatcggtctgctggac
gtgttcacccccgatgacaccctggacgacttcaacgacttctacctggtgatgcccttc
atgggtaccgacttgggcaaaatcatgaaacacgagaagctctctgaggatcggatccag
ttcctggtctaccagatgctcaagggtctcaagtacatccatgacgccgggatcatccac
cgggacctgaagccggggaatctggctgtgaatgaagactgtgagttgaagattctggac
ttcggcctggccaggcagacggatagtgagatgaccggctacgtggtcacccgctggtac
cgagcccccgaggtcatcctcaactggatgcactatacccagacagtggatatctggtcc
gtgggctgcatcatggccgagatgatcactggcaagatcctcttcaaaggcaatgaccgt
atccttagggcggccgaggtgggcgttggggcagtgccggggaccgaccggggtggccca
a

DBGET integrated database retrieval system