KEGG   Ornithorhynchus anatinus (platypus): 100093310Help
Entry
100093310         CDS       T01045                                 

Definition
cyclic AMP-responsive element-binding protein 1-like
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    100093310
   04024 cAMP signaling pathway
    100093310
   04022 cGMP - PKG signaling pathway
    100093310
   04151 PI3K-Akt signaling pathway
    100093310
   04152 AMPK signaling pathway
    100093310
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100093310
  Endocrine system
   04911 Insulin secretion
    100093310
   04915 Estrogen signaling pathway
    100093310
   04918 Thyroid hormone synthesis
    100093310
   04916 Melanogenesis
    100093310
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100093310
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100093310
  Nervous system
   04725 Cholinergic synapse
    100093310
   04728 Dopaminergic synapse
    100093310
  Development
   04380 Osteoclast differentiation
    100093310
  Environmental adaptation
   04710 Circadian rhythm
    100093310
   04713 Circadian entrainment
    100093310
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100093310
   05215 Prostate cancer
    100093310
  Neurodegenerative diseases
   05016 Huntington's disease
    100093310
  Substance dependence
   05030 Cocaine addiction
    100093310
   05031 Amphetamine addiction
    100093310
   05034 Alcoholism
    100093310
  Infectious diseases
   05152 Tuberculosis
    100093310
   05166 HTLV-I infection
    100093310
   05161 Hepatitis B
    100093310
Transcription factors [BR:oaa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100093310
Mitochondrial biogenesis [BR:oaa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100093310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 218 aa AA seqDB search
MANRIKKIDTIRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYI
AITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQ
AASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNRCYPGNTILP
QLLVLDCKFEFLSLCMASLVQANTSPPFSLDFSTANTT
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccaatagaattaagaaaattgacaccatcaggaaaattttgaatgacttgtcctca
gatgccccaggagttcccaggattgaggaggagaagtctgaagaggagacatcagcacct
gccattaccactgtgacggtgccaactccaatttaccaaaccagcagtgggcaatatatt
gccataacccaggggggagcaatacagctggctaacaatggcacggatggggttcagggc
cttcagacgttaactatgaccaacgctgctgccactcagcctggcaccaccatcctgcag
tatgcccagaccactgatggacagcagatcctggtacccagcaatcaagtggttgtacaa
gctgcctcaggagatgtccagacctaccagattcgcacagctccaaccagtaccattgca
cctggggtagttatggcgtcttctccagcacttcctacccagcctgcagaagaggcagca
cgaaagagagaagtgcgcctaatgaagaacaggtgctacccaggtaacacaattcttcca
cagctattagttctggattgcaaatttgaatttttgtctttgtgtatggcctccctggtg
caggctaatacatcacctccgttttctttagacttctcgacagccaataccacctag

DBGET integrated database retrieval system