KEGG   Ornithorhynchus anatinus (platypus): 100093341Help
Entry
100093341         CDS       T01045                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 1-like
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100093341
   00514 Other types of O-glycan biosynthesis
    100093341
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100093341
Glycosyltransferases [BR:oaa01003]
 Terminal extension
  Sialyltransferase
   100093341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 245 aa AA seqDB search
MVHINLLKKLMYVLLAFLLFLTICLWKETRKGYYVSFKSETRSFQLPRTLGKWGGELNPD
PGPKGRIQDPVQEAQPTTAPGDKAKPKKALSSLKVWNEDNSSKNLIPRLQKVRKNYLNMN
KYNVTYTGKRQTTKLSAGELLCQLRDRVNVTMIRETDVPFNTSEWKTYLPEDEISGKMGH
LGRCAVVSSAGSMKSSHLGPEIGEQLEQASLKIMLHYSYIFSGIEAVFPICPTAPIDYSC
NEVQL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggttcatatcaacctgctgaaaaaattgatgtatgtcctcttggcttttcttctgttc
ctgactatttgtttgtggaaggaaacaagaaaaggctattatgtctctttcaagtcggag
acgagaagttttcagttgcctaggacactggggaagtggggcggtgagctgaatccggat
ccaggccccaagggaaggatacaggatccagtccaagaggcccagcccaccaccgcgccg
ggagacaaagccaagcccaagaaagccctgagctccctcaaagtctggaacgaagacaat
tcttccaagaatctcatcccgaggctgcagaaggttaggaaaaattacctgaatatgaac
aagtataacgtgacatatacggggaaacggcaaaccacgaagctcagtgctggggagctt
ctctgtcagcttcgggaccgagtgaatgtgaccatgattcgagagaccgatgtccccttc
aatacctccgaatggaagacctacctaccggaggacgagatcagtgggaaaatggggcat
ttggggagatgtgctgtggtgtcatctgctgggtccatgaagtcatcacatctaggccca
gagataggtgagcagttagaacaagcctctctaaaaatcatgctacattattcgtacatt
ttctctggaattgaagctgtctttcccatctgccccactgcccccatagattatagctgt
aatgaagttcaactg

DBGET integrated database retrieval system