KEGG   Ornithorhynchus anatinus (platypus): 100093349Help
Entry
100093349         CDS       T01045                                 

Definition
histone H2B type 1-O-like
Orthology
K11252  
histone H2B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:oaa05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:oaa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:oaa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 126 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaccccgccaagtccgccccagcccccaaaaaggggtcgaagaaggcggtgacc
aaagcgcagaagaaggacgggaagaagcgtaagcggagccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtccaccccgacacgggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcttcccgc
ctggcgcactacaacaagcgctccaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system