KEGG   Ornithorhynchus anatinus (platypus): 100093481Help
Entry
100093481         CDS       T01045                                 

Definition
(RefSeq) histone H2B type 1-P-like
  KO
K11252  
histone H2B
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100093481
  Immune diseases
   05322 Systemic lupus erythematosus
    100093481
  Substance dependence
   05034 Alcoholism
    100093481
Chromosome [BR:oaa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100093481
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100093481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 146 aa AA seqDB search
MPERVQNSTLSSETSVQPGDKMSDTVKSVPVPTEGSWKAVAKDQKTRKKRKHSRRENYSI
YVYKVLKQVHPLTSISTKAVGIMDSFINDIFDRIASEASRLARYTKRSTIASREIQTAVL
LTLPGELARHAVSEGTKAITKYTSAK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaagagtccagaactcaaccctgtcctccgagaccagcgtccagccaggagac
aagatgtctgacacagtcaagtccgttccagtgcccacagagggctcgtggaaggcggtg
gccaaggatcagaagacccgcaagaagcgcaagcacagccgcagggagaactactccatc
tacgtgtacaaggtgctgaagcaggtccacccgctcacgagcatctcgaccaaggccgtg
ggaatcatggactcatttatcaatgacatcttcgaccgtatcgccagcgaggcctcccgc
ctggcgcgctataccaagcgctcgaccatcgcatcccgggagatccagacagccgtgctg
ctgacgcttcccggggaactggccaggcatgcggtgtccgagggcaccaaggccatcacc
aagtacacctcggcgaaatga

DBGET integrated database retrieval system