KEGG   Ornithorhynchus anatinus (platypus): 100093512Help
Entry
100093512         CDS       T01045                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100093512 (AGMAT)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     100093512 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 261 aa AA seqDB search
FGPRRIREESVLLRRMNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRQIREAYQKIVAS
HCIPLTLGGDHTITYPILQAVAEKYGPVGLVHVDAHTDTADQALGEKLYHGTPFRRCVDE
GILDCKRVVQIGIRGSSNTVDPYKFSRDQGFRVVLAEDCWLKSLVPLMGEVRKQLGNKPI
YISFDIDSLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNIVGCDLVEVAPMYDSSGNT
ALLAANLLFEMLCALPQVKTV
NT seq 787 nt NT seq  +upstreamnt  +downstreamnt
gtttggacctcgccgcatccgggaggagtcagtattgttgcggaggatgaatccaagcac
tggagcccttcctttccaatccctcatggtagcagacctaggggacgtgaacgtcaacct
ttacaacctccaagacagctgtcggcaaatccgagaagcctaccagaaaatcgtagcttc
ccactgtattcctctcaccctgggtggagatcacacaatcacgtaccccatcttgcaagc
agtggcagaaaaatacgggccagtagggctagtgcacgtggatgcccacacggacacggc
tgaccaagccttgggagagaagctgtaccacgggactccctttcgccggtgtgtggacga
aggaatcctggactgcaagcgagtggtgcagattggcattcgaggctcttccaatactgt
ggacccttacaaattcagcagagaccagggtttccgggttgtcctggctgaagattgctg
gctcaagtcattggtgccgctgatgggagaagtcaggaaacagttggggaacaaacccat
ttacatcagttttgatatagattccttggatcctgcctacgctcccggtactgggacacc
tgagattgcaggtctcacacccagtcaggctttggagatcatccgtggatgtcaagggct
gaacatagttggctgtgaccttgttgaagttgcaccaatgtatgatagctctggaaacac
agcgctcttagcagccaacctgctgtttgaaatgctgtgcgccctccctcaagtgaaaac
tgtctga

DBGET integrated database retrieval system