KEGG   Ornithorhynchus anatinus (platypus): 100093591Help
Entry
100093591         CDS       T01045                                 

Definition
histone deacetylase 2-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:oaa04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:oaa04110]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:oaa04919]
Human Diseases; Cancers; Pathways in cancer [PATH:oaa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:oaa05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:oaa05203]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:oaa05220]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:oaa05016]
Human Diseases; Substance dependence; Alcoholism [PATH:oaa05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:oaa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 455 aa AA seqDB search
MGTLSFCLDVSKEGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEE
MTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVK
LNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGV
EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKP
IISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGY
TIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIK
QRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDS
EDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKA
NT seq 1366 nt NT seq  +upstreamnt  +downstreamnt
atgggtacactgtcattttgtcttgatgtaagtaaagaaggtgatattggaaattattat
tatggccagggtcatcccatgaaaccccaccggatccgcatgacccacaacttgctgctc
aactatggcttgtacagaaaaatggaaatttataggcctcataaggccacagctgaagaa
atgaccaaataccacagtgatgaatacatcaaatttctgcgctcgataagaccagacaac
atgtccgagtatagcaaacagatgcagagattcaatgttggagaagattgtcctgtgttt
gatgggctgttcgaattctgccagttgtcaaccggagggtctgtagctggggcggtgaaa
ttaaaccgtcagcagactgacatggctgttaactgggctggaggtctccatcatgctaag
aagtcagaggcatcaggtttctgttacgtgaatgatattgtgcttgccatcctggaatta
ctgaaataccatcaaagagtgttatacattgatatcgacatccatcatggggatggtgtt
gaagaagctttttatacaacagaccgggttatgacagtatcattccataagtatggtgaa
tacttccctggtaccggagacttaagggatattggtgcaggaaaaggaaagtactatgcc
gtcaactttccgatgagagatggtatagatgatgagtcatacggacagatattcaaacca
ataatatcaaaagtgatggaaatgtatcagcctagtgctgtagtattgcagtgtggagca
gattcactgtcgggagacaggcttggatgtttcaatctaactgtcaaaggccatgcaaaa
tgtgtggaagttgtgaagaccttcaacttacctctgctgatgcttggaggaggcggctat
acaatccgcaatgttgctagatgctggacctatgagactgctgttgccttagattgtgaa
attcctaatgagttgccatataacgattactttgagtattttggacccgacttcaagctg
cacattagtccctcaaatatgacaaaccagaacaccccagaatatatggagaagatcaaa
cagcgtctgtttgagaacctgcgtatgttgcctcatgcccccggggtacagatgcaagct
attcctgaggatgcagtccatgaagacagtggagatgaagatggagaagatccagacaag
agaatttccattagagcatctgacaaacggatagcttgtgatgaagagttctccgactct
gaggatgaaggggaaggagggcgtcggaatgtggctgatcacaagaaaggagcaaagaaa
gccagaatagaagaagacaagaaagaaacagaggacaagaaagcag

DBGET integrated database retrieval system