KEGG   Ornithorhynchus anatinus (platypus): 100681922Help
Entry
100681922         CDS       T01045                                 

Definition
protein disulfide-isomerase TMX3-like
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100681922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 189 aa AA seqDB search
CPPAPRHRGDPASDPRPRWRPPWGRATPAQTALDAQNSRQASVLGVTLEAGVIEDLDDSF
KESRKDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMRSIGSPVKVGKMDATSYSSVASEFG
VRGYPTIKLLKGDLAYNYRGPRTKDDIIEFANRVSGPLIRPLPSQPMFEHVQKRHRVFFV
YIGGESPLK
NT seq 569 nt NT seq  +upstreamnt  +downstreamnt
ggtgtcctcctgccccccgtcatcggggagaccccgcatctgacccgaggcctcgatggc
gacctccctggggacgggccacccctgctcaaaccgccttagatgctcagaacagtcgtc
aggcctcggtgcttggcgtgactttggaggcaggtgttatagaagatttagatgactcgt
ttaaagagagtcgaaaagatgacatctggcttgtagatttttatgcaccatggtgtggcc
attgcaaaaaattggaacccatttggaatgaagttggtttggagatgagaagtattggat
cgcctgttaaagttggaaagatggatgctacttcctattctagtgttgcttcagagtttg
gagttcgaggatatccaacaattaaactcttaaagggagatttggcatataactacagag
gacccagaaccaaagatgatatcattgagtttgctaacagagtgtctgggcctctaatcc
ggccccttccgagccagccgatgtttgaacacgtgcaaaagaggcatcgtgtgttttttg
tttatattgggggagaatcacctttaaag

DBGET integrated database retrieval system