KEGG   Ornithorhynchus anatinus (platypus): 100681922Help
Entry
100681922         CDS       T01045                                 

Definition
(RefSeq) protein disulfide-isomerase TMX3-like
  KO
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100681922
Chaperones and folding catalysts [BR:oaa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100681922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 203 aa AA seqDB search
CPPAPRHRGDPASDPRPRWRPPWGRATPAQTALDAQNSRQASVLGVTLEAGVIEDLDDSF
KESRKDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMRSIGSPVKVGKMDATSYSSVASEFG
VRGYPTIKLLKGDLAYNYRGPRTKDDIIEFANRVSGPLIRPLPSQPMFEHVQKRHRVFFV
YIGGESPLKVGREDVEIKKRVLC
NT seq 614 nt NT seq  +upstreamnt  +downstreamnt
ggtgtcctcctgccccccgtcatcggggagaccccgcatctgacccgaggcctcgatggc
gacctccctggggacgggccacccctgctcaaaccgccttagatgctcagaacagtcgtc
aggcctcggtgcttggcgtgactttggaggcaggtgttatagaagatttagatgactcgt
ttaaagagagtcgaaaagatgacatctggcttgtagatttttatgcaccatggtgtggcc
attgcaaaaaattggaacccatttggaatgaagttggtttggagatgagaagtattggat
cgcctgttaaagttggaaagatggatgctacttcctattctagtgttgcttcagagtttg
gagttcgaggatatccaacaattaaactcttaaagggagatttggcatataactacagag
gacccagaaccaaagatgatatcattgagtttgctaacagagtgtctgggcctctaatcc
ggccccttccgagccagccgatgtttgaacacgtgcaaaagaggcatcgtgtgttttttg
tttatattgggggagaatcacctttaaaggtaggccgtgaagatgtagagattaaaaaaa
gagtgttatgttga

DBGET integrated database retrieval system