KEGG   Ornithorhynchus anatinus (platypus): 100682155Help
Entry
100682155         CDS       T01045                                 

Definition
carboxylesterase 3-like
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100682155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 213 aa AA seqDB search
MQTMNFSGLKEGMTRETILSTIKSVRAIMDIPSELVHLLADEYLGIEKDPLALRDAFLDL
MGDRFFVIMSFKTAQYHRDAGAAVYFYEFQHRSSLISKIKPDYVKADHGDEITFVFGGPF
MANESFLFAFPGAREEEKQLSKTMMQYWANFARTGDPNGKGLFHWPLFDLTESYLELNLT
PKIGKKLRGAKMEFWMKTLPEAIWKYQEGKKEL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatgaacttttctggactgaaagagggaatgactagagaaactattctatct
acaataaagtctgtaagagccataatggacattccctctgagttggtgcatttgttagct
gatgagtatctggggattgaaaaggacccacttgctctgcgagatgcctttctggacttg
atgggagatagattcttcgtaataatgtctttcaaaacggcccagtaccatagagatgcc
ggtgcagcagtctacttttatgaatttcagcatcgatcaagtttgatcagcaaaatcaaa
cctgattatgtgaaagctgatcatggagatgaaatcacctttgtctttggaggtcccttc
atggccaatgagagcttcttatttgcttttccaggggccagggaggaggagaaacagctg
agcaaaaccatgatgcaatactgggcgaactttgctaggaccggagaccctaatggaaaa
gggctgttccactggcccctctttgacctgaccgaatcatacctggaactaaacttgacc
ccaaagatcgggaagaaactgagaggtgccaagatggagttttggatgaagactcttcct
gaagcaatctggaagtatcaagaagggaagaaggagctgtaa

DBGET integrated database retrieval system