KEGG   Oscillatoria acuminata: Oscil6304_0034Help
Entry
Oscil6304_0034    CDS       T02368                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
oac  Oscillatoria acuminata
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oscil6304_0034
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oscil6304_0034
   00520 Amino sugar and nucleotide sugar metabolism
    Oscil6304_0034
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Oscil6304_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(44056..44766)
Genome map
AA seq 236 aa AA seqDB search
MVNQVESIKTLAVDIGGSGTKTIVLDAAGEAVTKRNRVPTPDPAKPEPVIEAIASLAKEQ
GEFDRVSVGFPGVVRNGIIYTAVNLHPDWVEFNLAEALTKVLERPVRVCNDADIQGLGAI
SGKGVELTITLGTGFGSGLFVNGTLVPNLELGHHPFRKGDTYEEQLGRAALDKVGDKRWN
RRLEKAIANLEHLFNYDRLYIGGGEAKKITFDLPPNVTVVPNISGLLGGIALWRDP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatcaagtggaatccataaaaactctagcagttgatattggcggtagtggcacg
aagaccattgttttagatgcagcaggggaagcggtgactaaacgtaaccgcgttcccact
ccggatcccgctaaaccggaacctgtgattgaggcgatcgcctctttagcgaaagaacaa
ggtgagtttgatcgcgtttcggtcggatttcctggggtggttcgtaatggaatcatctac
actgccgtcaacctccacccggattgggtggagttcaatctcgccgaagcgctgacgaag
gttttggaaagacctgtacgggtttgtaatgatgccgatatccagggtttaggcgcaatt
tccgggaaaggggttgaactcacgattaccctgggaactgggtttggcagtgggttattt
gtgaatggaacactggtgccgaatttggaactcggacatcatccattccgcaaaggtgat
acctatgaggaacaattgggacgtgcggcattggataaagtgggagacaaacggtggaat
cgccgattggaaaaagcgatcgccaatttagaacatttgtttaattacgatcgcctctac
attggtggtggtgaagcgaaaaaaatcacctttgatttaccccccaatgttaccgttgtt
cctaatatcagcgggttattagggggaattgccttgtggcgggacccataa

DBGET integrated database retrieval system