KEGG   Oscillatoria acuminata: Oscil6304_0035Help
Entry
Oscil6304_0035    CDS       T02368                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oac  Oscillatoria acuminata
Pathway
oac00010  Glycolysis / Gluconeogenesis
oac00020  Citrate cycle (TCA cycle)
oac00620  Pyruvate metabolism
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01120  Microbial metabolism in diverse environments
oac01130  Biosynthesis of antibiotics
oac01200  Carbon metabolism
Module
oac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oscil6304_0035
   00020 Citrate cycle (TCA cycle)
    Oscil6304_0035
   00620 Pyruvate metabolism
    Oscil6304_0035
Enzymes [BR:oac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Oscil6304_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase PASTA
Motif
Other DBs
NCBI-ProteinID: AFY79795
UniProt: K9TBA6
Position
complement(45140..46408)
Genome map
AA seq 422 aa AA seqDB search
MINEVFMPALSSTMTEGKIVSWEKAPGDKVEKGETVVVVESDKADMDVESFYEGYLATIL
VQAGEAAPVGAAIALLAETEAEIEQAKQQGANLSNKSAQPAAAPQSTPSPAPEPAMATAG
APASRQNGRTVASPRAKKLAKEYKVDLATLSGSGPFGRIVAEDVEAAAGKAPAATATPAQ
PTVAAPPRIPTQAVPPAASGDVVPFNTLQNAVVRNMVASLQVPIFHVGYTITTDQLDKLY
KQIKSKGVTMTALLAKAVALTLQKHPLLNASCVDGGIQHHGNINIAVAVAMGDGGLITPV
LQNADQMDIYSLSRTWKDLVERARVKQLQPAEYNSGTFTLSNLGMYGVDSFDAILPPGQG
SILAIGGAKNQVVATDDGMMGVRRQMRVNITCDHRIIYGADAAAFLQDLAKLIETDAQSL
TM
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgattaacgaagtgttcatgcctgctctgagttccacgatgaccgaaggcaaaattgtc
tcttgggaaaaagcgccgggggacaaagtggagaagggcgaaacggtggtggtggtggag
tctgacaaagcagacatggacgtagagtccttctatgaaggttatctcgctacgatcctg
gtacaagctggagaagctgcccccgtaggcgcggcgatcgccttgttagctgaaacggaa
gccgaaatcgaacaggcgaagcagcaaggggcgaacctcagcaacaaatcggctcaaccg
gcagccgctccccagtctaccccatcccctgcaccggaaccggcaatggctacggctgga
gcccccgctagtcgtcaaaatggccgcacagttgcctctcctcgggccaaaaaattggcg
aaggaatacaaagtggatttggcaaccctctccggcagtggtccttttggtcggattgtg
gcggaagatgtagaagcagcagcaggtaaggccccagccgcgactgccaccccagcgcaa
ccgacggtagcagcacccccgagaattcccacccaggcagtcccccccgcagcctcggga
gatgtggtccccttcaataccctgcaaaatgcggtcgtccggaatatggtggcgtcatta
caggtgccgattttccatgttggctatacgattaccacggatcaattagacaaactctac
aaacagattaagtccaaaggggtgaccatgactgctctactggcaaaagcagtggccctc
acgttacagaaacatcctttactcaatgccagttgtgtggatggagggattcaacatcat
ggcaatatcaatattgctgtagcggtggcaatgggagatggcgggttaattacgccggtt
ctgcaaaatgccgaccaaatggatatttactccctatctcgcacttggaaggatttggtg
gaacgcgcccgagtcaaacagttgcaaccggcggagtataatagcgggacttttaccctg
tccaatttgggaatgtatggggttgatagttttgatgcgattctgcctccgggtcagggt
tcgattctcgccattggtggggcaaaaaatcaagtggttgccacggatgatggcatgatg
ggggtccggcgacaaatgcgggtgaatattacctgtgaccaccggattatctatggtgcc
gatgctgcggcattcttgcaagatttagcgaagttgattgaaactgatgctcagtctctc
acgatgtag

DBGET integrated database retrieval system