KEGG   Oscillatoria acuminata: Oscil6304_0046Help
Entry
Oscil6304_0046    CDS       T02368                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
oac  Oscillatoria acuminata
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Oscil6304_0046
Enzymes [BR:oac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Oscil6304_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(55700..56905)
Genome map
AA seq 401 aa AA seqDB search
MTEEPTFQSPNSHSPNNHQPMRETEASRALEREAQLPMTGWQQEVSKGLEYGLEGADSIR
DRSIPTFSRGELPHYAGINTFLKAPYLEDVRQVGNYDVAVVGVPHDSGTTYRPGTRFGPQ
GIRRISALYSPYNFELGVDLREQITICDAGDIFTIPANNEKSFDQISKGIAHIFSSGAFP
IILGGDHSIGYPTVRGICRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNIKNA
PPQNLVQLGIGGWQVPRQGVKVCRERATNILTVTDITEMGLDAAVEFALERALDGTDCVY
ISFDIDCIDAGFVPGTGWPEPGGLLPREALYLLGKIVQRAPVCGLEVVEVSPPYDISDIT
SLMATRVICDTMAHLVLSGQLPRKEKPYYIHPEAQPELVVG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaacctacatttcaaagcccaaattctcattctccgaataatcatcaaccg
atgagagaaaccgaagcaagtcgcgccttggaacgagaggcacagttgccgatgacgggg
tggcagcaggaagtctccaaaggattggaatatggacttgaaggcgcagatagcatccgc
gatcgcagtatccccactttttctcggggtgaattacctcattatgccgggattaacacc
tttttaaaagcaccctatttagaagatgtgcgccaggtggggaactatgatgtcgccgtc
gtgggtgttcctcacgattctggcacgacttatcgtcccggtacaagatttggtccccaa
ggaattcgccgcatttccgccctttatagcccttacaattttgaactgggagtggatttg
cgcgaacaaattacaatttgtgatgccggagatatctttaccattcccgccaacaacgaa
aaatcattcgaccaaatttctaaagggattgcccatatttttagttccggtgcatttccg
attattcttgggggtgatcactccattggatatcccacagtccgggggatttgtcgtcat
ttaggggataaaaaagttgggattattcacttcgatcgccatgtggatacccaggaaacc
gatttagatgaacggatgcatacttgcccctggtttcatgccaccaatatcaaaaatgca
ccgcctcaaaatctagtccagcttggtatcggaggatggcaagttccccgtcaaggagtg
aaagtttgtcgggaaagagcaacgaatattttaaccgtcactgacatcaccgaaatgggt
ttagatgcagcggtggaatttgctttagaacgagctttagatggcactgattgtgtatat
atcagctttgatattgattgcattgatgccggttttgtccccgggacgggatggcctgaa
ccgggcggtttactgccccgagaagccctctatttgttggggaaaattgtgcaacgcgcc
ccggtttgtggcctagaagtggtggaagtttctcccccttacgatatcagtgatattacc
tccttgatggcaactcgggtgatttgcgatacgatggcccatttggtgttatccgggcag
ttacctcgcaaagaaaagccctattatatccatcccgaagctcaaccggaattagtggtg
ggataa

DBGET integrated database retrieval system