KEGG   Oscillatoria acuminata: Oscil6304_0278Help
Entry
Oscil6304_0278    CDS       T02368                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
oac  Oscillatoria acuminata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Oscil6304_0278
Enzymes [BR:oac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Oscil6304_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330780..332285
Genome map
AA seq 501 aa AA seqDB search
MPFPRSSGILLHPTSFPSRFGIGDLGEAAYRFVDFLAESYQLYWQILPLGPTGFGNSPYL
SYSAMAGNPMLISPDRLRQDELLADWDFDQVPEFPADWVDFNQAIAIKMPLLQQACQTFK
AQASAEQKQQFQEFCHEKAYWLDDYALFMAIKGAMDGKSWYQWEPDIAKRQTEALDKWRR
QLTGEIFFQKFLQYQFFRQWSDLKRYANERNIQIIGDIPIYVAHDSADVWANPDIFCLDV
KTGEPAGMAGVPPDYFSATGQLWGNPVYLWKRLEKQDFDWWVKRFQSMLSYVDIIRIDHF
RGLESFWCVRQGETTAMNGKWIPAPGSALLKTVKERLGSLPIIAEDLGVITPEVEALRDE
FEFPGMKILHFAFGSGPGNPYLPLNYYSRNCVVYTGTHDNDTTVGWFEKLSDHERWGLLS
YLGPVSEEGIHWQLIRVALSSVANQALIPFQDLLGLGSDGRMNTPGLAEGNWGWRYRGEV
LTWDLRDRLKLLTETYGRRCY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcccttccccagatctagcggtattctactccaccccacttcatttcccagtcggttt
ggtatcggtgaccttggcgaagccgcttatcgcttcgttgactttttagcagagagttac
caactttactggcaaattttgccgctaggacctacaggatttggcaattctccctatttg
tcctattccgcaatggcgggaaatccgatgttgattagtcccgatcgcctgcgacaagat
gaattgctcgcggattgggactttgaccaagtacccgagtttccggcagattgggtcgat
tttaaccaggcgatcgccatcaaaatgcccttgttacaacaagcctgccaaaccttcaaa
gctcaggcttctgcggaacagaaacagcaatttcaagaattttgccatgaaaaagcctat
tggcttgacgattatgccttattcatggcgattaaaggcgcaatggatggcaaaagctgg
tatcagtgggaacccgacattgccaagcggcaaaccgaggccctagataaatggcggcga
cagttaaccggcgaaatctttttccaaaaattcctgcaatatcaatttttccggcaatgg
tctgacctcaaacgctacgccaacgaacgaaatatccaaattatcggcgatattcccatc
tatgtcgctcatgatagcgccgatgtttgggccaatccagacatcttttgtctggatgtc
aaaactggagaaccggcaggaatggcaggagtcccgcccgattatttcagcgccacgggg
caattatggggtaacccggtttacctctggaaacgcctggaaaaacaggactttgattgg
tgggtcaagcgcttccaatccatgttgagttatgtggatatcattcgcatcgaccatttc
cggggcctagagtccttctggtgcgtgcgccaaggggaaaccaccgccatgaatggaaag
tggattccggcaccgggttcggccttactgaagaccgtcaaagaacggttaggcagtctg
ccgattattgcggaagatttaggggtgattacgccagaagtggaagccctacgagacgag
ttcgagtttccggggatgaagattttacactttgcctttggatcgggacccgggaatccc
tatttgccgcttaactattactcgcgcaactgtgtggtttataccgggactcacgataat
gatacgacggtgggatggtttgaaaaactgtcggaccatgaacggtggggtcttttatcc
tatttaggacccgtttctgaggaaggcattcactggcaattgattcgagtggcattgtcc
tccgtggcgaatcaagccctgattcccttccaggatttgttgggactaggcagtgatggg
cggatgaatacgccgggattggccgaaggcaattggggatggcgttatcgcggggaagtg
ctgacctgggacctgcgcgatcgcttgaaactactcacggaaacctatggtcgtaggtgc
tattag

DBGET integrated database retrieval system