KEGG   Oscillatoria acuminata: Oscil6304_0329Help
Entry
Oscil6304_0329    CDS       T02368                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
oac  Oscillatoria acuminata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
390050..391120
Genome map
AA seq 356 aa AA seqDB search
MKLRSFIAYILVMLAIVLAIATTSTATNPEPPRTDSTAESLRLLAAKRDFLIGTAVRPFP
LKNEPIYGEVLAREFNIIMPEHHLKFAPVHPERDRYDFSVADEIVNFAQEHDIKVIGHAL
VWFHALPRWVVEGNFSREELLEILHDHIQTVVGHYRGQIYAWDVVNEPVEADGTFRETIW
YKTIGPEYIDLALRWTHEADPDALIYINDYGEGLNSKSDSFYLLAKSLQERGAPLDAIGF
QTHIGFLSAKDSQEVAENMKRYAELGLDVMFTEMDVPINQFSGTEEEQLAAQAEMYRDFL
NICLEASNCNTMLTWGFTDRYTWLTGFTGGKAPLIFDESYRPKPTYSAMLEELKGS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcgttctttcatcgcatatattttggtgatgctggcgatcgttttggcgatc
gccaccacaagtaccgcgacaaatccagaacccccccgcaccgattccacagcagaatcc
ctgcgattgctggcagcaaagcgggactttttaattggaactgctgtcagacccttcccc
ttaaaaaacgagccgatctatggagaggtcctggcccgtgaatttaatatcatcatgccc
gagcatcatctgaaatttgctcccgtgcatccagagcgcgatcgctatgattttagcgta
gccgatgagatcgtcaattttgctcaagaacacgatataaaggtcattggtcatgcactg
gtctggtttcacgccctcccccgttgggtcgtggaggggaatttttcccgggaagaactc
ctggaaattctccatgatcacattcagactgtagtcggtcactatcgaggtcaaatttat
gcttgggatgtggttaatgaacccgtagaagccgatgggaccttcagagaaaccatctgg
tataaaactattggaccggaatatattgacctagcgctgcgttggactcatgaagccgat
ccagatgccctcatatatattaatgactatggggaaggactcaactctaaatcagattcc
ttttatctgttagcaaaatccctccaggaacggggtgcacccctagatgcgatcggtttc
caaacccacatcggctttttatctgcaaaagactcccaagaagtcgctgaaaatatgaag
cgctacgccgagttgggtttagacgtgatgtttactgagatggatgttccgattaatcag
tttagcggcaccgaagaggagcaattagccgcacaagctgaaatgtaccgggattttctg
aatatttgcctagaggcatcgaactgtaacaccatgctgacatggggatttaccgatcgc
tatacttggttaaccgggtttactggagggaaagccccattaatttttgacgagtcctat
cgtcctaaacccacctattctgcgatgttggaagaattgaaagggagttaa

DBGET integrated database retrieval system