KEGG   Oscillatoria acuminata: Oscil6304_0341Help
Entry
Oscil6304_0341    CDS       T02368                                 

Definition
putative bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
oac  Oscillatoria acuminata
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Oscil6304_0341
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Oscil6304_0341
Enzymes [BR:oac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Oscil6304_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
407351..409813
Genome map
AA seq 820 aa AA seqDB search
MTTPSTPPQIPSQTWQRPIGLDWDKPYTVRYGSNLDDGPWHGMPLGGFGAGCIGRSPRGD
FNLWHLDGGEHTFQSLPACQFSIFEETQNQRHAYALCTEPPSDGSLNSWQWYPASTEENP
TGTYHALYPRSWFVYQNVLKAQLTCEQFSPILPGKYQECSYPLAIFEWTAYNPTDEPITL
SILLTWENVVGWFTNAIKSPTVKVRDDGSPVYEYQSKWGQSQGNSNRYIEDFHRIGCIMA
GGHLGEVPQEGEGELAIATATNPFLDTFKNTRWNPTGSGKEVWEQFSHDGSLLDCTDETP
AAKGERIGVALAVRFTIRPGKTRKIPFILAWDFPVTEFAAGVWEYRRYTDFFGRHGKNSW
SMIRTALKHSEMWRENIITWQQSILDREDLSDSLKMALFNELYILTDGGTLWTAQDAEEP
RGKFAVLECIDYRWYESLDVRLYGSFALLMLWPELEKSVMRGFARAIPTGDDTPRIIGYN
QAAAIRKVTDATPHDLGAPNEHPWVKTNYTSYQDCNLWKDLPCDFALLVYRDFLLTGGDD
YEFLWDCWPSMVQAIAYLKTFDTDGDGIPENGGAPDQTFDDWPMRGVSAYCGGLWIAALQ
AAIAIGEVILNNPPHSGVFTDTIYEQKRSQLLEPATIQATLSTYQDWLEQSRPLYQHKLW
NGTYYRLDSESGSEVVMADQLCGQFYARLLGLADIVPIDCAESALKTVYESCFLKFHNGE
FGAANGVLIDGSPVNPDATHPLEVWTGINFGLAAFLLQMGMKEEGFKLTETVIQQVYENG
LQFRTPEAITAVGTFRASHYLRAMAIWAVYGMFTGFKEGK
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgacgactccatccactccccctcaaattccttcccagacttggcagcgtcccattggt
ttagattgggacaaaccctataccgttcgctatggcagtaatctcgatgatggtccctgg
catggaatgcccctcgggggttttggggccggttgtataggccgatcgcctcgcggtgac
ttcaatctctggcatctcgacgggggcgaacataccttccaatcccttcccgcctgtcag
tttagcatctttgaagaaactcaaaaccagcgtcacgcttacgcactttgtaccgaaccc
ccctccgatggcagtttgaattcctggcaatggtatcccgcctcgactgaggagaatcct
accggaacctaccatgctttgtaccctcggagttggtttgtttatcaaaatgtcttgaaa
gcacaactcacttgtgagcaattttccccaattttgccaggaaaataccaagaatgtagc
tatcccctggcaatttttgaatggactgcttacaatcccaccgatgaaccgattacccta
agtattctgctgacttgggaaaatgtggtgggttggtttaccaatgccatcaaatccccc
acagttaaagtgcgagatgatggttcacccgtctatgaataccaatctaaatgggggcaa
agtcagggcaattctaaccgctatattgaagatttccatcggattgggtgtataatggcc
gggggtcacttgggggaggttccccaggaaggagagggagaactggcgatcgccaccgcc
accaatccctttctcgataccttcaaaaacacccgatggaatcccaccggcagcggcaaa
gaagtctgggaacagttttctcacgatggttccttattggattgtaccgatgaaacccct
gccgccaagggagaacggattggggtcgcattggccgttcgcttcaccattcgaccggga
aaaactcggaaaattccctttatactcgcttgggattttcccgtgacagaattcgctgcc
ggagtctgggaataccgccgctacacagacttttttgggcgtcatggtaaaaattcctgg
tccatgattcgcactgcactcaagcattcggagatgtggcgtgagaatatcatcacttgg
caacaatcgatattagaccgggaggatttgtccgactcgttaaaaatggcactgttcaat
gaattatatattctcactgatgggggaacattatggactgcccaggatgcggaggaacct
cggggtaagtttgccgttctggaatgtatcgattatcgttggtatgagagcttggatgtg
cgcttatatgggtcgtttgccctgttaatgttgtggccggaattggaaaaatcggtgatg
cgcgggtttgccagggcgattcctacgggggatgatacaccccggattattgggtataat
caagcggcagcgattcgcaaagtgaccgatgccacaccccatgatttgggtgcaccgaat
gaacatccttgggtgaagacgaattataccagttatcaggattgtaatttgtggaaggat
ttaccctgtgattttgccttgctggtgtatcgggattttctgttgacggggggagatgat
tatgagtttttatgggattgttggccctcaatggtgcaggcgatcgcctatttaaaaacc
ttcgataccgatggggatgggattccggaaaatggcggggcaccggatcaaacctttgat
gattggccgatgcggggggtaagtgcctattgtggcggattgtggatagcggcattacaa
gcagcgatcgccattggtgaggtaattttaaacaatcccccccattccggcgtgttcacc
gatacgatttatgaacagaagcgatcgcaattactggaaccggcaacgattcaagcaacc
ctgagtacctatcaagattggttggaacaatcacgccccctgtatcaacacaaactctgg
aatggcacttattatcgcctagacagcgaaagcggttcggaggtggtaatggcggatcag
ctttgtggtcaattctatgcgcggttattagggttagccgatattgtgccaatagactgt
gcagaatcagccttgaaaaccgtctatgagtcttgttttctgaagtttcataatggggaa
tttggggcagccaatggggtattaatcgatggttctccggtgaatcctgatgcaacccat
ccgctagaagtctggactgggattaatttcggattggcggcatttttgttacaaatgggg
atgaaagaggaagggtttaaattgaccgaaaccgtgattcagcaagtgtatgaaaatggg
ttgcagttccgcactccggaagcgattacagcagtgggaacgtttcgcgcttctcattat
ttacgggcgatggcaatttgggccgtttatgggatgttcactgggtttaaagaggggaaa
tag

DBGET integrated database retrieval system