KEGG   Oscillatoria acuminata: Oscil6304_1146Help
Entry
Oscil6304_1146    CDS       T02368                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
oac  Oscillatoria acuminata
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:oac00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1409703..1410998)
Genome map
AA seq 431 aa AA seqDB search
MKRETKEFIVEGQKIINIKIVKAITLLGSTGSIGTQTLDIVEHHPDRFRIVGLAARGNVE
LLAQQIRQFRPEIVAICLEDKLPELRAAIADLDPQPILLAGEKGVVEVARYGDAEAVVTG
IVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVNPLIEKHGVKLLPADSEHSAIFQCL
QGVPPGGLRRIILTASGGAFRDWPVEKLATVKVADALKHPNWSMGRKITVDSATLMNKGL
EVIEAHYLFGMDYDDIDIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERI
YTEWERLDLVKAGDLTFRSPDHHKYPCMKLAYAAGRAGGSMPAVLNAANEQAVELFLEEK
IAFLDIPRVIERVCDRHQADNCAEPGLEEILAADRWARQAVLEASATLKAEAKSFTSGVK
PLGNVTPATAG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagggagaccaaagaatttatagtggaggggcagaaaatcataaatattaaaatt
gtgaaagcgattactctcctcggatccactggttcaatcgggactcagacgttagatatt
gtggaacaccaccccgatcggtttcggattgtggggttagcagctagagggaatgtggaa
ctgttggcgcaacaaattcgccagtttcgcccagaaatcgtcgccatctgcctggaagac
aagctgccggaactacgcgcggcgatcgcagatttggacccacaaccgatcctcctagcg
ggagaaaagggagtggtggaagtggcgcgttacggggatgcggaagcagttgtcacggga
attgtcggttgtgcggggttactgcccacgatcgccgcgatcgaagcgggtaaagatatc
gccttggcgaacaaggaaaccttgattgctgggggacctgtggtcaatcccctgatcgaa
aagcatggggtcaagttacttcctgccgactcggaacattcggcaatctttcaatgtttg
caaggggtcccgcctggggggttgcgtcggattattttgaccgcttccgggggggccttc
cgggattggccggtggagaaattagcaacggtgaaagtggcggatgcgttgaagcatccc
aactggtcaatggggcgtaaaattaccgttgattcagcgaccttaatgaataaaggatta
gaagtcattgaggcgcactacttatttggaatggattatgatgatattgatattgtgatt
catcctcagagtattattcactctttaattgagttacaggatacttcagttttagcccaa
ttgggttggccggatatgcgtctgccgttgctttatgccttgtcttggccggagcgaatt
tatacggagtgggaacggttagatttagtaaaagcgggagatttgaccttccgatcgccg
gatcatcacaagtatccctgtatgaaattggcttatgctgccggtcgggccggggggtct
atgccggcggttttaaatgccgctaatgagcaggcagtggagttatttttagaggagaaa
attgcgtttttggatattcctcgggtgattgaacgggtctgcgatcgccatcaggcggat
aactgtgccgaacccggtttagaggagattctagctgccgatcgctgggccagacaagca
gttttagaagcaagtgctactctgaaagctgaggctaaatcctttaccagtggggtcaag
cctttggggaatgtgactccggcaaccgctggatag

DBGET integrated database retrieval system