KEGG   Oscillatoria acuminata: Oscil6304_1345Help
Entry
Oscil6304_1345    CDS       T02368                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
oac  Oscillatoria acuminata
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:oac02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1645606..1646616
Genome map
AA seq 336 aa AA seqDB search
MKIAIVNDMLLAIEALRRVLTSVPDYELLWVARNGAEALNKCAVVRPDLILMDVFMPVMD
GVEATRQIMRDCPCAILLVTSSINTHLPKVFEALGYGALDVVITPILGYYGTAEGGETLL
EKIRTIHKLLGKPLSKKPKNLIPVKSCYRNQPYPPLVAIGASTGGPTAIAKILSQLPQDF
RISVAIVQHIDVQFSASFVQWLSQQTRLKVELAEVGMTPQPGKIIVAGTNDHLFMRPDRT
LGYTKHPLNNPYRPSVDVFFTSLAENWPGQGLGVLLTGMGRDGAVGLSVLRGAGWQTIAQ
DANSCIVYGMPKAAVELGAVQQSLTPEAIGIKLLSL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcgattgttaatgatatgctgttggcaatagaagccttacggcgcgtctta
acatcagtgccggactatgaacttctctgggtggcccggaatggtgctgaagccctaaac
aaatgtgctgtagtccgaccggatctcattttaatggacgtattcatgcccgtgatggat
ggggtagaggcaactcgccagattatgcgtgattgtccctgtgcgatattgctggtgact
tctagtattaacactcacttaccgaaagtatttgaagccctcggatatggggcgcttgat
gtggtgattacgccgattctcggatactacggaactgccgaaggaggagaaaccctcctg
gaaaaaattaggacaattcataaattactgggtaaacccctcagcaaaaaacccaaaaat
ctgattccagttaagtcctgttataggaatcaaccctatccccccctggtggcgatcgga
gcttctaccggaggtcccacggcgatcgccaagattttgtctcagttaccccaggatttt
agaatatccgtggcgatcgtccagcatatcgatgtccagttttccgccagttttgtccag
tggttatcccagcaaacccggttaaaagtcgagttggctgaagtgggaatgaccccgcaa
ccgggtaaaattatagtggccggaactaacgatcatctcttcatgcgtcccgatcgcacc
cttggctatactaaacatcccctgaataatccttatcgtccctcggtggatgtttttttt
accagtttggctgaaaactggccgggacaaggattaggggtgttgctcaccggcatggga
cgagatggagccgtggggttgagtgtcttgcgaggggcaggttggcagacgatcgcccaa
gatgccaacagttgcatcgtctatggaatgccaaaagctgcggttgaattaggagccgtt
caacaaagtttgactcccgaggcgatcggcatcaaactcctcagtctctaa

DBGET integrated database retrieval system