KEGG   Oscillatoria acuminata: Oscil6304_1826Help
Entry
Oscil6304_1826    CDS       T02368                                 

Definition
(GenBank) glutathione S-transferase
Organism
oac  Oscillatoria acuminata
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2217499..2218122
Genome map
AA seq 207 aa AA seqDB search
MSTASITEAVLAELAIPFDLVTLNISVGDTITAEFLKVNPNGRVPAIVHEGTAIWESSAI
TMYLGEVFGVEANLYPAPGPKRGEAMKWIAWSNVTFAEAASRLFASLPPEKQGDPETNVQ
EEVAPEMKSAIAMEKAKADLADCLSILNGGLEGRSFLIGDYSLADTHLQGIVGWIGSMEV
DLAPFPNVTGWLQRCYERPAIARLMVG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtccacggctagtatcactgaagccgttctggcagaacttgctataccgttcgatctc
gtaacactcaatatcagtgttggagacactataacggctgaatttctgaaggttaaccca
aacggcagagtccctgcaatcgtgcatgaaggaacagcgatttgggagtcttctgcgatc
acaatgtacctcggtgaagtctttggcgtagaggccaatctttatcccgccccagggcca
aagcgtggcgaagccatgaaatggatcgcatggagtaacgttacttttgcagaggcggct
agccgtttattcgcatccttgccacctgaaaagcagggagatcctgagactaacgtgcag
gaagaagtagcccctgagatgaaaagtgcgatcgcaatggagaaagcaaaagcggatctt
gctgattgtctcagcattctcaatggtgggttggaaggacgatcatttttaatcggtgac
tatagcctcgcagacactcatctgcaaggcatcgttggttggatcggttcaatggaggtt
gatttggctcctttccccaacgtcacaggatggctgcagcgctgctacgagcgtccggcg
atcgctaggttgatggtaggctaa

DBGET integrated database retrieval system