KEGG   Oscillatoria acuminata: Oscil6304_1865Help
Entry
Oscil6304_1865    CDS       T02368                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
oac  Oscillatoria acuminata
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:oac00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:oac00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:oac00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:oac00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2267498..2268406
Genome map
AA seq 302 aa AA seqDB search
MNQSTAPIRKAIIPAAGFGTRLFPATKALKKELLPIIDRDGRVKPTILAIVEEAISAGIE
EVALIVQSGDSAFFENFFKTPLTDIHYNKLSPENQAYSQYLQALGQKITLLTQESQEGYG
HAVFCAKDWVNDEPFLLFLGDHVYLSDTDQSCASQLVEVYNRVGKSTVALTVTPATEIYH
CGCVTGNWQDNDGILSLTQVCEKPDLDYARKNLIVEGLTGDRFLTVFGIYALTPTIFDFL
EANIRNNLREKGEFQLTTCLEQVREAEGMYGYQIKGRCFDTGMPDAYYQTFIDFREFNRP
KP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatcaaccgctcccattcggaaagccattattcccgccgcaggatttggtact
cgattgttccctgccacaaaagcccttaaaaaagaactattgccgattatcgaccgggat
ggtcgggttaaacccacgattttagccattgttgaagaagccatcagtgctggcattgaa
gaagtagctctcattgttcaaagtggagattccgccttttttgaaaacttttttaaaacc
ccattaaccgacatacattacaacaaactttcccccgaaaatcaagcctatagccagtat
ttacaagcattaggccagaaaataaccctattaactcaggagagtcaagaagggtatggc
catgcggttttctgtgccaaagactgggtaaatgatgaaccctttctactatttttaggg
gatcatgtttatttatcggataccgatcagtcttgcgccagccaactcgtggaggtttat
aatcgggttggaaaaagtaccgttgccctcacggtaacgcccgcaacagaaatttatcac
tgtggttgtgtaacgggaaattggcaagataacgatggaattttatcccttacccaagtt
tgtgaaaagccggatttagactatgcccgaaaaaatttaatagtagaaggattaacaggc
gatcgcttcttaaccgtgtttggaatttatgcccttactcccacaatatttgactttctc
gaagccaatatccgcaataatctccgagaaaaaggcgaatttcagctcaccacctgccta
gaacaagtgcgtgaagcggaaggaatgtatggctatcaaatcaagggacggtgttttgat
acaggaatgcctgatgcctattatcagacgtttatcgattttcgagaattcaaccgtcca
aagccctaa

DBGET integrated database retrieval system