KEGG   Oscillatoria acuminata: Oscil6304_1865Help
Entry
Oscil6304_1865    CDS       T02368                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
oac  Oscillatoria acuminata
Pathway
oac00040  Pentose and glucuronate interconversions
oac00052  Galactose metabolism
oac00500  Starch and sucrose metabolism
oac00520  Amino sugar and nucleotide sugar metabolism
oac01100  Metabolic pathways
oac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Oscil6304_1865
   00052 Galactose metabolism
    Oscil6304_1865
   00500 Starch and sucrose metabolism
    Oscil6304_1865
   00520 Amino sugar and nucleotide sugar metabolism
    Oscil6304_1865
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Oscil6304_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFY81538
UniProt: K9TGL0
Position
2267498..2268406
Genome map
AA seq 302 aa AA seqDB search
MNQSTAPIRKAIIPAAGFGTRLFPATKALKKELLPIIDRDGRVKPTILAIVEEAISAGIE
EVALIVQSGDSAFFENFFKTPLTDIHYNKLSPENQAYSQYLQALGQKITLLTQESQEGYG
HAVFCAKDWVNDEPFLLFLGDHVYLSDTDQSCASQLVEVYNRVGKSTVALTVTPATEIYH
CGCVTGNWQDNDGILSLTQVCEKPDLDYARKNLIVEGLTGDRFLTVFGIYALTPTIFDFL
EANIRNNLREKGEFQLTTCLEQVREAEGMYGYQIKGRCFDTGMPDAYYQTFIDFREFNRP
KP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatcaaccgctcccattcggaaagccattattcccgccgcaggatttggtact
cgattgttccctgccacaaaagcccttaaaaaagaactattgccgattatcgaccgggat
ggtcgggttaaacccacgattttagccattgttgaagaagccatcagtgctggcattgaa
gaagtagctctcattgttcaaagtggagattccgccttttttgaaaacttttttaaaacc
ccattaaccgacatacattacaacaaactttcccccgaaaatcaagcctatagccagtat
ttacaagcattaggccagaaaataaccctattaactcaggagagtcaagaagggtatggc
catgcggttttctgtgccaaagactgggtaaatgatgaaccctttctactatttttaggg
gatcatgtttatttatcggataccgatcagtcttgcgccagccaactcgtggaggtttat
aatcgggttggaaaaagtaccgttgccctcacggtaacgcccgcaacagaaatttatcac
tgtggttgtgtaacgggaaattggcaagataacgatggaattttatcccttacccaagtt
tgtgaaaagccggatttagactatgcccgaaaaaatttaatagtagaaggattaacaggc
gatcgcttcttaaccgtgtttggaatttatgcccttactcccacaatatttgactttctc
gaagccaatatccgcaataatctccgagaaaaaggcgaatttcagctcaccacctgccta
gaacaagtgcgtgaagcggaaggaatgtatggctatcaaatcaagggacggtgttttgat
acaggaatgcctgatgcctattatcagacgtttatcgattttcgagaattcaaccgtcca
aagccctaa

DBGET integrated database retrieval system