KEGG   Oscillatoria acuminata: Oscil6304_2030Help
Entry
Oscil6304_2030    CDS       T02368                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
oac  Oscillatoria acuminata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:oac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2471325..2473370
Genome map
AA seq 681 aa AA seqDB search
MTAPSTSTITAFPLTAVVGQEAIKLALLLTAVDPGLGGLAIAGRRGTAKSVMARAIHALL
PPIEVVKDSIANCNPTNPDEWDDLTRETYPTQGTNSTTPDEVPTQIIPAPFVQIPLGVTE
DRLLGSVDVEQSVKQGDTVFQPGLLAQAHRGVLYIDEINLLDDQIANLLLSVLTDGRNQI
EREGISFQHPCKPLFIATYNPEEGSLREHLLDRIAITLSADGVLGVDQRVEAVEQALSYS
ASPQAFLHQYTEDIDNLKTQILLAREWLKDVEIQSDQIAYLVNEALRGGVQGHRAELFAL
RVAKASAALDGRTAVNAEDLRRAVELVIVPRSTIVQTPPEEEQPPPPPPPPPQDNSDQQQ
EEPEEEEPEEQDEQEQPEQEQSIPEEFLFDPEGVIMDPSVLYFAQMAKRQGKTGSRTIIF
SDDRGRYIKPMLPKGKVQRVAVDATLRAAAPYQKARRERQPDRKVIVEQGDLRSKRLARK
AGALVIFVVDASGSMALNRMQSAKGAVLQLLTEAYQNRDQIALIPFRGEQADVLLPPTRS
ITSARRRLERLPCGGGSPLAHGLTTAVRVGLNAQQSGDIGQVAIVAITDGRGNVPLSRSL
GEPAIEGEKPDIKGELLEIAGKIRGVGMQLLMIDTENKFVSTGFAKELAKAAGGRYYSLP
KATDRAIADMARGALAEMKSR
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcccagcacctctaccatcacagcatttcctctgacagcagttgtcggtcag
gaggcgattaaactcgccctactgttaaccgcagtagaccccggattgggaggactggcg
atcgccggtcgtcggggaaccgccaaatccgtgatggcgcgtgccatccacgccctgttg
cccccgattgaagtggtcaaagactccatcgccaactgcaatcccaccaatcccgatgaa
tgggacgacctcacccgcgagacttatccaacccaagggaccaacagcaccactcccgat
gaggtgcccacccaaatcattcccgccccttttgtccaaatccccctcggagttacagaa
gaccgtcttttagggtccgtggatgtggaacagtcggtcaagcaaggggacacggtattt
caaccgggtttactcgcccaggcgcatcggggagttctctatattgatgaaatcaacctc
ctcgatgaccaaattgccaacctgctgttaagcgtcctcaccgatggacgcaaccaaatc
gaacgggaagggattagcttccaacatccctgcaaacccctgtttatcgccacctataac
cccgaggaagggtccctgcgcgaacatctccttgatcgcattgccattaccctctccgcc
gatggggtcctgggcgtagatcagcgcgtagaagcggtggaacaagccttatcctactct
gcctccccccaggcgttcttacaccaatacaccgaagacattgacaacctcaaaacccaa
attctcctcgcccgagaatggttaaaggatgtggaaattcaatcggaccagattgcttat
ctggttaatgaagccctccgaggcggggtccagggtcatcgcgccgaattatttgccctg
cgggtcgctaaggcatcggcggccctggatggtcgtaccgctgtcaatgcggaggacctc
cgtcgggcagtggaattggtgattgtcccccgttcgacaattgtgcaaacgccaccggag
gaggaacaaccaccaccaccaccgccaccgccaccgcaagacaactcggatcagcaacaa
gaggaaccggaggaggaagaaccggaagaacaagacgaacaggaacaaccggaacaggaa
caaagtattcccgaagagtttctgttcgaccctgaaggggtgatcatggacccgagtgtg
ctgtatttcgcacaaatggcgaaacggcaaggcaagaccggcagtcgcacaattattttt
tccgacgatcgcggacggtacattaagcccatgttacctaagggtaaggtgcaacgggtg
gcggtggatgcgacgttacgcgctgctgcaccctatcagaaagcccgccgggaacggcaa
ccggaccgcaaggtgattgtggaacagggggatttgcgatcgaagcggttggcgcgaaaa
gccggtgctttggtaatttttgtggtggatgcctcgggttcaatggcactcaaccggatg
caatcggcgaaaggggctgtattacaactgctgacggaagcgtatcaaaaccgggaccaa
attgccttaattccgtttcggggagaacaggcggatgtgttgttacccccgacgcgatcg
attacttccgcccgcagacggttggaacggttgccctgtgggggtgggtcgcccttagca
catgggttgaccacggctgtgcgggtggggttaaatgctcaacaatccggggatatcggt
caggtggcgatcgttgctattaccgatggacgggggaatgttcccttgtctcggtccttg
ggtgaaccggcgatcgaaggtgagaaaccggatattaagggagaattactggaaattgcc
ggtaaaattcgcggggtagggatgcaactgttgatgattgatacagagaataagttcgtt
tccacagggtttgcgaaagagttggccaaagcggctgggggtcgatattatagtttaccc
aaggccacggaccgggcgatcgcagatatggctagaggtgctttagctgaaatgaaatct
cgatag

DBGET integrated database retrieval system