KEGG   Oscillatoria acuminata: Oscil6304_2071Help
Entry
Oscil6304_2071    CDS       T02368                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
oac  Oscillatoria acuminata
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Oscil6304_2071
Enzymes [BR:oac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Oscil6304_2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2524356..2525081)
Genome map
AA seq 241 aa AA seqDB search
MTIAASHGSQLPETGNGMKSAQTSDKTPRIETRPDRNTLNGAQANIHQPPAESADQMMEA
FREVLIGVGEDPEREGLLKTPKRAADAMRFLTSGYNQSLEELLNGAIFDEGHNEMVLVRD
INFFSLCEHHMLPFMGRAHVAYIPNEKVVGLSKLARIVEMYSRRLQVQERLTRQVAEAIQ
SILEPKGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGQFQEEQKTREEFLNLIRHQPSF
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactattgctgcttcccacggatcccaattacccgagactggaaatggtatgaaatct
gcccaaacctcagacaaaactcctcgcattgagactcggcccgatcgcaataccttaaat
ggtgctcaagccaatattcatcaacccccggcagaaagcgccgatcaaatgatggaggcg
ttccgcgaagtgctcatcggggttggggaagatccagaacgggaagggttactcaagacc
ccaaaacgggcggcggatgccatgcgttttctgacgagtggttacaatcaatcgttagaa
gaattgttgaatggagccatctttgacgaaggacataacgagatggtactggtgcgagat
attaatttcttcagcctctgcgaacaccatatgcttccgtttatgggccgcgcccatgtt
gcctatatccccaatgaaaaagttgtgggattgagcaaactcgcccgtatcgtcgagatg
tacagccgcaggcttcaggtgcaagagcgcctcacccgccaggtcgccgaagccattcaa
agcattttagaaccgaaaggggtggctgtcgtcatggaagcaactcatatgtgcatggtc
atgcggggggtccaaaaaccgggttcctggacggtaaccagtgcgatggtgggtcaattc
caggaagagcaaaagactcgggaagagtttcttaacctgattcgtcatcaaccctctttc
ttttag

DBGET integrated database retrieval system