KEGG   Oscillatoria acuminata: Oscil6304_2154Help
Entry
Oscil6304_2154    CDS       T02368                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
oac  Oscillatoria acuminata
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:oac00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2630837..2631496)
Genome map
AA seq 219 aa AA seqDB search
MLKLYYNLISLNSRRVWISLLEKGLPFELVPMKLDGDQFQGEFLALNPFHQVPVLEDEGF
VLVESLAILDYLEAKYPTPSLLPADPQMLGTVKMIELLTLTQMMPPMRPLMMNWMGFSQE
SLEKLQEAKQNLAQVLGFFESKLADRPYFGDQQLTLADIVAGTAIPFLPSMGLPLDDYPQ
LKDWCDRLMTRESWQQTQPTEKEITEFKTQMKILLSQRP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagctatactacaatctcatttctttgaactctcgccgggtctggatctcctta
ttagagaaagggctaccatttgaattggtcccgatgaaactcgatggcgatcagtttcaa
ggggagtttttggcactcaatccgtttcaccaagttccggttttggaagatgagggattt
gtgctcgtggagtctttggcaattttggattacttagaggcaaaatatccgactccttct
ttactgcctgcggatccgcagatgttaggaacggtgaaaatgattgagcttttgacttta
actcagatgatgcccccgatgcggcccttgatgatgaattggatggggttttcgcaagaa
agtctggaaaagttgcaggaagcgaaacagaatcttgcccaggtgttaggcttttttgaa
agtaagttagccgatcgcccctattttggagaccaacagctcaccttggccgatattgtt
gccggaactgcgattccatttttgccgagtatgggattacccctggacgattatcctcag
ttaaaagattggtgcgatcgcctgatgacccgcgagagttggcagcaaacccaacccact
gagaaagaaattacagaatttaagacccaaatgaaaatcttgctctctcagcgcccgtaa

DBGET integrated database retrieval system