KEGG   Oscillatoria acuminata: Oscil6304_2274Help
Entry
Oscil6304_2274    CDS       T02368                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
oac  Oscillatoria acuminata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Oscil6304_2274
Enzymes [BR:oac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Oscil6304_2274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2755617..2756630)
Genome map
AA seq 337 aa AA seqDB search
MLVSRSKRKFFLTIFFCSILLITGLFSWVHSTVEAVEGTPWLHVEGIDIKDPNGHKVVLR
GVSLPDLALNDYRDGEGKWATELIEMLTDGENGWYSTVIRLPVYPIWEHGYNNDPQRYDQ
RYIRPAVEKCVEKNIYCIIDWHYVDDPRDVDRETRAFWSDIAVKYKDYPNIMFEVFNENK
TDMSWAEWKSITQPWVDLIRSYAPKNIILVGAPHYSQHLFDTPDNPIEGENLVYVAHVYP
GLKEHHWDRWMFNSADKIPIFVTEWGFRKGSSKTTSGTISTYGRAIKKKLEDHQLSWTCW
VADYSWKPEMFDSDWNLLVGENNMGGFVKDYLAEKRG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtaagccgttcaaaacgtaaattttttctaacgattttcttttgctctattttg
ttgatcacgggattattttcatgggttcattctaccgttgaagccgttgaaggcactcct
tggctgcacgtggaagggatagatatcaaggacccaaatggtcataaagtcgttttgcga
ggggtatcacttccggatctagccctgaatgactatcgggacggcgagggaaagtgggca
acggaattaatcgagatgctaaccgacggggaaaatggctggtactcgactgtaatccga
ctccccgtctatccgatatgggaacatggatacaataacgatccccagcgatacgatcag
cgatatatcagacctgccgtggaaaaatgcgtcgaaaaaaatatttactgtattatcgat
tggcactatgtcgatgatcccagggacgtagatcgagaaactcgggctttctggtcggat
atcgctgtcaaatataaagattatccaaacattatgtttgaggtctttaatgaaaataag
accgatatgagttgggccgagtggaaaagtattactcaaccttgggttgatctgattcgc
agttatgcgcctaaaaacatcattctagtgggagcacctcactattctcagcatttattt
gatactccagataacccgattgagggggagaatctcgtttatgttgctcatgtatatcct
ggactcaaagaacatcattgggatcggtggatgtttaactcggcggataaaattccgatt
tttgtgacggaatgggggtttagaaagggttctagtaaaaccaccagtggaacgatttca
acttatggcagggcaatcaagaagaagttagaagaccatcagttaagttggacctgttgg
gtggccgattattcttggaagccggaaatgtttgattcagactggaatttgctagttggg
gaaaacaatatggggggttttgtaaaagattatctcgccgaaaaaagagggtaa

DBGET integrated database retrieval system