KEGG   Oscillatoria acuminata: Oscil6304_2330Help
Entry
Oscil6304_2330    CDS       T02368                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
oac  Oscillatoria acuminata
Pathway
oac00860  Porphyrin and chlorophyll metabolism
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Oscil6304_2330
Enzymes [BR:oac01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Oscil6304_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 ABC_tran AAA DUF815 AAA_18 AAA_28 AAA_30 AAA_27 AAA_7 MMR_HSR1 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFY81959
UniProt: K9TIV9
Position
2822067..2823158
Genome map
AA seq 363 aa AA seqDB search
MSPIAQAIPTQPAIARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTT
IRALADLLPEIEVVADDPFNSHPSDPELMSDVVRDRVSRGETVPLMQRKVQMIDLPLGAT
EDRVCGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNT
VEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPALRVKIVEERSGF
DQNPQTYLEQHETEQQALQQKLIDAQNLLPSVNLDYEMRVQISQVCSELDVDGLRGDIVT
NRAAKAIAALEGRTEVTLDDIRRVITLCLRHRLRKDPLESIDSGYKVQKVFSSVFGVEMS
EEG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgattgcccaagctattccaactcaacccgcgatcgcgcggcgtgctgtgttt
ccttttactgctattgtggggcaggaagaaatgaaactggcattgctgctgaatgtcatt
gaccccaagattggcggggtgatgattatgggcgatcgcggcactggcaagtctactacc
atccgcgccttagctgatctgctgccagaaattgaagtggtggcagatgaccccttcaat
agtcatccctcggatcctgaattgatgagtgatgtggtccgcgatcgcgtctctcgggga
gaaacggtgcccctgatgcagcgcaaggtgcaaatgattgacctccctctcggtgctaca
gaggaccgggtttgtggcaccattgatattgaaaaagccctttcggaaggggtaaaagcc
tttgaaccgggtttattagccaaagccaatcgcggtatcctctatgtggatgaagtcaac
ctcctcgatgatcacctcgtggatgtgttgttagactccgctgcttcgggatggaatacc
gttgaacgggaagggatttccattcgtcacccggcgcgatttgtattggtggggtccggt
aacccagaagaaggtgaactccgtccccaattgctcgatcgcttcggaatgcacgccgaa
atccgcacggtgaaagaacccgctttacgggtgaaaatcgtcgaggaacgctcaggattt
gaccaaaatcctcaaacttatttagaacaacatgaaacggaacaacaggcgttacagcaa
aagctgattgatgctcaaaacctgttgccttcggtgaatttggattatgaaatgcgcgtc
caaatttcccaggtttgttctgagttagatgtggatgggttgcgcggagatattgtcacc
aaccgcgctgccaaggcgatcgctgcgttggaaggacgcacggaagtcaccctggatgat
atccgtcgcgtgattaccctctgtctgcgtcaccgcctccgcaaagaccccttagaatcc
attgatagtggttataaggttcaaaaagtctttagcagtgtctttggcgtagaaatgtca
gaagaaggttaa

DBGET integrated database retrieval system