KEGG   Oscillatoria acuminata: Oscil6304_2900Help
Entry
Oscil6304_2900    CDS       T02368                                 

Definition
alcohol dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
oac  Oscillatoria acuminata
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Oscil6304_2900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oscil6304_2900
   00620 Pyruvate metabolism
    Oscil6304_2900
   00650 Butanoate metabolism
    Oscil6304_2900
  Lipid metabolism
   00071 Fatty acid degradation
    Oscil6304_2900
  Amino acid metabolism
   00350 Tyrosine metabolism
    Oscil6304_2900
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Oscil6304_2900
   00626 Naphthalene degradation
    Oscil6304_2900
Enzymes [BR:oac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Oscil6304_2900
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Oscil6304_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3581466..3584168
Genome map
AA seq 900 aa AA seqDB search
MNSKVTNTEELEQLIQRVKAAQEKYATYSQQQVDEIFKKAALAANSARIPLAKKAVAETG
MGVVEDKVIKNHFASEIIYNKYKHEKTCGIIEEDKSFGFQKIAEPVGILAGIVPTTNPTS
TAIFKALLALKTRNGIIFSPHPRAKECTRDAAKIILEAAVAAGAPEDLIGWIDEPTVPLS
QHLMQHPDIKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAVIDETAHIKMAVSSILISK
TFDNGMICASEQSVIVVDEVYEEVKQEFSDRGAYFLNPEERQKLGSKIIVNGRLNPDIVG
QSIQKLAEIAGISVPEETRVLIGEVEEISEAEPFAYEKLSAILAMYRATDFHDSVHKAHD
LVQFGGRGHTAVLYTSPANTKNIHEFEGQMQTARVLINTPSSQGAIGDLYNFRLDPSLTL
GCGTWGGNSISENVGPQHLLNIKTISERRENMLWFRIPPKVYFKYGSLPVALRELAGKQR
AFIVTDKPLYDMGLTKSVEEVLEEIGLKYDIFFDVEPDPSLTTVNKGLARMNSFKPDVII
ALGGGSPMDAAKVMWLMYEHPEIEFEGLATRFMDIRKRVYELPPLGIKAIMVAIPTTSGT
GSEVTPFAVVTDDRTGIKYPLADYALTPNMAIVDPELVLNMPKKLTAYGGIDALTHALEA
YVSVCASEFTNGLALEAIRLLFKYLPSSYKNGAKDPKAREKVHYAATIAGMAFANAFLGV
CHSMAHKLGSTFHVPHGLANALMISHVIRYNATDVPFKQAIFPQYKYPNAKWRYARIADY
LGLGGENEQEKIENLVEAIENLKKELDIPLTLKEALSGDDKAFYEEVEEMADQAFDDQCT
GANPRYPLIRDLKELYVLAYRGCRIDSALYHQESQEEVLQGNGADAVTSVIQPVMVESNS
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaaagtcacgaacactgaagaactcgaacaactcattcagcgcgtcaaagca
gcccaagaaaaatatgccacctacagtcagcaacaggtggatgaaattttcaagaaagcc
gctctagccgccaactcagcccgaattcccctggctaagaaagccgtggccgaaaccggc
atgggagtcgtggaagacaaagtgattaaaaaccactttgcctcagaaattatctacaac
aaatataagcacgaaaaaacctgcggcatcattgaagaagacaaatcttttggcttccaa
aaaatcgccgaacccgtgggaattctcgcggggatcgttcccacaaccaaccccacttcc
acggctatttttaaagccctcctcgccctaaaaacccggaacgggattattttctctcct
cacccccgggcgaaagaatgcacccgagatgcggcaaaaatcatcctggaagctgccgta
gctgccggagcacctgaagacctgatcggctggattgacgagccaacggtgccgttatcc
cagcacttgatgcagcatcctgatattaaattaatcctggcaactggcggtccgggtatg
gtcaaagctgcctattcttccggacatccgtccctgggtgtgggggccgggaatactccg
gcggtgattgatgaaactgcccatattaaaatggctgtttcctccatcctgatcagcaaa
acctttgacaatgggatgatttgcgcctcagaacaatcggtgattgtggtggatgaggta
tatgaggaggtcaaacaggaatttagcgatcgcggcgcatatttcctgaatccggaagaa
cggcaaaaactcggcagcaaaatcattgtcaacggacgcttaaatcccgatattgtcgga
caatccattcaaaaactggctgaaattgctggaatttccgttcccgaagagacgcgggtg
ctgattggtgaagtggaagagatttccgaagctgaaccctttgcctacgagaaactttcg
gctatcttagccatgtatcgggcgacagattttcacgattcggtccataaagcccatgac
ttagtgcagtttggcggacggggacatactgctgtactctatacctctccggcgaatact
aagaatatccacgaatttgaagggcaaatgcaaacggcgcgggtgctgattaataccccc
tcctctcaaggggcgatcggtgacctgtataacttccgcctcgacccctccctcactctc
ggttgcggcacttggggaggcaactccatcagcgaaaacgtgggtccccaacatttgctc
aacatcaaaaccatctcggaacgccgggaaaatatgctgtggttccggattccgcccaaa
gtgtactttaaatatggttctctcccagtcgccctccgggaactcgcaggaaaacaacgc
gcctttatcgtcaccgataaaccgttgtacgacatgggtctcaccaagtccgtggaagaa
gtcctcgaagaaattgggctcaaatatgacatcttcttcgacgtggaacccgatccatcc
ctgactacggtcaataagggactggcgcggatgaactctttcaaacctgacgtgattatc
gcccttgggggaggttccccgatggatgcggcgaaagtcatgtggttgatgtatgaacat
ccggaaatcgaatttgaaggactcgccacccggtttatggacatccgcaaacgggtgtac
gaactgccgccattgggtattaaagcgattatggttgccattccgacaacctcgggaaca
ggttcagaagttacccccttcgccgtcgtcaccgacgatcgcacggggatcaagtatccc
ctggcagattacgccctcactccgaacatggcgatagtcgatccggaattggtgctgaat
atgcccaaaaaactcaccgcttatggtggtatcgacgccctcacccatgccttagaagcc
tacgtttccgtctgtgcgtctgagtttaccaacggattggccttagaagcgattcgtctg
ctgtttaagtatctgccttcctcctacaaaaacggggccaaagacccgaaagcgcgggag
aaagtgcattatgccgcgacgatcgccgggatggcatttgccaacgccttcctcggggtc
tgtcactcaatggcgcacaaactgggttcaaccttccatgttccccacgggttagccaat
gccctgatgatttctcacgtcatccggtataatgcgactgacgtgccctttaagcaagcc
atcttcccgcaatacaaatatcccaatgccaaatggcggtatgcgcggattgccgactat
ctgggactcggtggcgagaacgaacaagagaaaatcgagaacttggtagaggcgatcgag
aacctcaagaaagagttagatattcctctgaccctgaaagaagccctctctggggatgac
aaagccttctatgaagaagtcgaagaaatggcggatcaggcattcgacgaccaatgtacg
ggtgcaaatccccgctatcctctgattcgcgacctcaaggagttgtatgtcctagcttac
cgaggttgccgcatcgattcggctttgtatcatcaagaatctcaggaagaggtgttacaa
ggcaatggcgctgatgctgtaacttctgtcatccagccagtgatggtggaaagtaactct
taa

DBGET integrated database retrieval system