KEGG   Oscillatoria acuminata: Oscil6304_3191Help
Entry
Oscil6304_3191    CDS       T02368                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
oac  Oscillatoria acuminata
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Oscil6304_3191
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Oscil6304_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3924097..3925023
Genome map
AA seq 308 aa AA seqDB search
MNIVVFGSINLDLVTRTHRLPKPGETLAGISFFTASGGKGANQAVAAAKLGMTTWMIGRV
GGDSFGQELLESLQQSGVKCDRILIDENTTSGIATIAVEDTGENTIVIVPGANDRVNESD
CDRLTDLLPDAAALLLQLEIPLSAVLAAAKKAQDAGVPVILDPAPARELPPELYSLIDII
TPNETELSLLTGLAVRDVETAREAITELQKRGVKTAIAKLGGKGVLCARGEEQFFVPAFE
VEAVDTVAAGDAFNGALAVAIAQGLSLPEAVRWGAAAGALAVTKPGAQSALPSRLTFEEF
LREGKIKT
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgttgtgttcggtagtattaatctcgatttagtcacccgcacccaccgcctg
ccgaaacccggtgaaaccttggcgggaattagcttttttaccgcatccgggggcaagggt
gcaaatcaagcggttgctgcggcgaaattgggcatgacaacctggatgattggacgggtg
ggaggggatagttttggacaggaactgttggagagtttgcaacagtctggggtgaagtgc
gatcgcatcttaatcgatgaaaacactacttccggaattgccacgatcgccgtcgaggat
acgggagaaaataccattgtgattgtccccggggccaacgatcgcgtcaatgagtcagac
tgcgatcgcctcacggatttgttacccgatgcagcagcattattattacaattggaaatt
cccctatccgcagttttggcagcggctaaaaaagctcaggatgccggggttcccgttatt
ttagacccagcccccgcccgcgaactgcccccagaattgtattctttaattgatatcatt
accccgaatgaaaccgaactgagtctcctcaccggacttgccgtgagagatgtagaaaca
gcccgggaagccatcaccgaattgcaaaaacggggagttaaaacagcgatcgccaagtta
gggggaaaaggggtgctttgtgccaggggagaagaacagttttttgtccccgcctttgaa
gtggaagcggtggatacggtagccgcaggggatgcctttaatggcgcattagccgtggcg
atcgcccagggattgtccttacccgaggcggtaagatggggggctgctgccggtgccttg
gcggtgacgaaacccggtgctcaatctgccttacccagtcgcctcacctttgaggaattt
ctccgggaggggaaaataaagacttga

DBGET integrated database retrieval system