KEGG   Oscillatoria acuminata: Oscil6304_3278Help
Entry
Oscil6304_3278    CDS       T02368                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
oac  Oscillatoria acuminata
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Oscil6304_3278
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Oscil6304_3278
Exosome [BR:oac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Oscil6304_3278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4079497..4080999
Genome map
AA seq 500 aa AA seqDB search
MKNPTSNIILGLDLGTTGNRAILFNQEGQLIAQSYQELTQFYPQPGWVEHDPLAIWDDTY
HCIQQVLQNRGISGSEIAAIGLTVQRETCLLWDKTTGEPLHPAIVWLDRRTAPLCRELTE
KGHAAEIQNRTGLVLDAYFSATKLAWLLKWVKDNRPEINPQNILAGTIDTWILWKLTGSK
VHATDRSNASRTLLMNLETLNWDPILLNLFGIPQEIMPEIRDSFGYFGETDPDILGFSVP
IMAILGDQQAALFAHGCDRPGLVKCTYGTGCFLIAQTGQELVRSHHQLLSTVAWTDGNQV
NYALEGAMFTTGRSVQWLRDGLNLIDSAGETEAIARSVPDSNGAYFVPALSGLGAPHWDM
SARGAFFGLTAGVTRAHLVRAVLEAVAYQVKEVVDAINQDSDTPVQRLKVDGGACENDFL
MQFQADVLNIPLERPTVLDATAQGAAFAAGLAVGFWTDYSTLVQTRTLDRCFEPGEGKMT
TAPHFTQWQKAVSRAKNWVD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacccaacctcgaatatcattttaggactcgacctggggaccacaggaaatcga
gccattttatttaatcaagaaggtcaattaatcgctcaatcttatcaagaattaacgcaa
ttttatccccaacccggttgggtcgagcatgatccccttgctatctgggacgatacctac
cattgcattcaacaagttttacaaaaccgggggatttcggggtctgaaattgccgccatc
gggctaactgtccagcgggaaacctgtttgttgtgggataaaacaacgggagaaccctta
catccggcaattgtctggctcgatcgccggactgcacccctctgccgagagttgaccgaa
aagggtcacgctgctgagattcaaaatcgcacgggattagtgttggatgcctatttttcc
gccactaaactcgcttggttattaaaatgggtcaaggacaatcgacccgagattaatccg
cagaatattctcgctggaaccattgatacttggatactttggaaactaaccgggtccaag
gttcatgccaccgatcgcagtaatgccagtcgcaccctgttgatgaatttggaaacctta
aattgggacccaatcctattaaatttattcggaattccccaggaaattatgccggaaatt
cgcgacagtttcggctattttggagaaacggacccggatatcctggggttttctgtcccc
atcatggctattttaggcgatcagcaggcggcattattcgcccacggctgcgatcgcccg
gggctggtaaaatgtacttatggaaccggctgttttttaattgctcaaacgggtcaggaa
ttagtccgctcccatcatcaactcctctcaaccgttgcctggactgatggtaatcaggtg
aattatgccttagaaggcgcaatgtttaccacaggacgttcggtgcagtggttgcgagat
ggattaaacctgattgattcggcaggggaaaccgaggcgatcgcccgttccgttcctgat
agtaatggggcctatttcgtccccgccttgagtggactcggtgcaccccattgggatatg
agtgcaagaggagcattttttggactcaccgccggagtaacccgagcacatctggttcgc
gctgttttagaggcagtcgcctatcaagtgaaagaagtcgtcgatgccatcaatcaagat
agtgacaccccagtacaacggttaaaagtcgatggcggcgcttgcgaaaatgattttctc
atgcaatttcaagccgatgtcctgaacattcctctcgaacgtcctacagtccttgatgct
accgctcaaggtgccgcctttgctgctggtttagccgtgggtttctggaccgattattcc
accctagttcaaactcgcactctggatcgctgctttgaacccggagaaggaaaaatgacc
acagccccgcattttactcaatggcaaaaggcggtaagtcgagctaaaaattgggtagat
tga

DBGET integrated database retrieval system