KEGG   Oscillatoria acuminata: Oscil6304_3278Help
Entry
Oscil6304_3278    CDS       T02368                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
oac  Oscillatoria acuminata
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:oac00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4079497..4080999
Genome map
AA seq 500 aa AA seqDB search
MKNPTSNIILGLDLGTTGNRAILFNQEGQLIAQSYQELTQFYPQPGWVEHDPLAIWDDTY
HCIQQVLQNRGISGSEIAAIGLTVQRETCLLWDKTTGEPLHPAIVWLDRRTAPLCRELTE
KGHAAEIQNRTGLVLDAYFSATKLAWLLKWVKDNRPEINPQNILAGTIDTWILWKLTGSK
VHATDRSNASRTLLMNLETLNWDPILLNLFGIPQEIMPEIRDSFGYFGETDPDILGFSVP
IMAILGDQQAALFAHGCDRPGLVKCTYGTGCFLIAQTGQELVRSHHQLLSTVAWTDGNQV
NYALEGAMFTTGRSVQWLRDGLNLIDSAGETEAIARSVPDSNGAYFVPALSGLGAPHWDM
SARGAFFGLTAGVTRAHLVRAVLEAVAYQVKEVVDAINQDSDTPVQRLKVDGGACENDFL
MQFQADVLNIPLERPTVLDATAQGAAFAAGLAVGFWTDYSTLVQTRTLDRCFEPGEGKMT
TAPHFTQWQKAVSRAKNWVD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacccaacctcgaatatcattttaggactcgacctggggaccacaggaaatcga
gccattttatttaatcaagaaggtcaattaatcgctcaatcttatcaagaattaacgcaa
ttttatccccaacccggttgggtcgagcatgatccccttgctatctgggacgatacctac
cattgcattcaacaagttttacaaaaccgggggatttcggggtctgaaattgccgccatc
gggctaactgtccagcgggaaacctgtttgttgtgggataaaacaacgggagaaccctta
catccggcaattgtctggctcgatcgccggactgcacccctctgccgagagttgaccgaa
aagggtcacgctgctgagattcaaaatcgcacgggattagtgttggatgcctatttttcc
gccactaaactcgcttggttattaaaatgggtcaaggacaatcgacccgagattaatccg
cagaatattctcgctggaaccattgatacttggatactttggaaactaaccgggtccaag
gttcatgccaccgatcgcagtaatgccagtcgcaccctgttgatgaatttggaaacctta
aattgggacccaatcctattaaatttattcggaattccccaggaaattatgccggaaatt
cgcgacagtttcggctattttggagaaacggacccggatatcctggggttttctgtcccc
atcatggctattttaggcgatcagcaggcggcattattcgcccacggctgcgatcgcccg
gggctggtaaaatgtacttatggaaccggctgttttttaattgctcaaacgggtcaggaa
ttagtccgctcccatcatcaactcctctcaaccgttgcctggactgatggtaatcaggtg
aattatgccttagaaggcgcaatgtttaccacaggacgttcggtgcagtggttgcgagat
ggattaaacctgattgattcggcaggggaaaccgaggcgatcgcccgttccgttcctgat
agtaatggggcctatttcgtccccgccttgagtggactcggtgcaccccattgggatatg
agtgcaagaggagcattttttggactcaccgccggagtaacccgagcacatctggttcgc
gctgttttagaggcagtcgcctatcaagtgaaagaagtcgtcgatgccatcaatcaagat
agtgacaccccagtacaacggttaaaagtcgatggcggcgcttgcgaaaatgattttctc
atgcaatttcaagccgatgtcctgaacattcctctcgaacgtcctacagtccttgatgct
accgctcaaggtgccgcctttgctgctggtttagccgtgggtttctggaccgattattcc
accctagttcaaactcgcactctggatcgctgctttgaacccggagaaggaaaaatgacc
acagccccgcattttactcaatggcaaaaggcggtaagtcgagctaaaaattgggtagat
tga

DBGET integrated database retrieval system