KEGG   Oscillatoria acuminata: Oscil6304_3281Help
Entry
Oscil6304_3281    CDS       T02368                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
oac  Oscillatoria acuminata
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Oscil6304_3281
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Oscil6304_3281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4085137..4085712
Genome map
AA seq 191 aa AA seqDB search
MNLAGKITLELLRTRKRFVYADPPLLPETMTSVLAAIALGSNLGDSPRILSEAIAHLDST
PGISVQQTSRWYQTAAIGPPQPDYLNGCALMQVQLTPHQLLERLLEIETQFGRIRRERWG
PRTLDLDLLFYDDTIVATPTLEVPHPRMRERAFVLVPLAEVAPDWVDPVSGEAVRQLLQR
LDISGVQTLYN
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagcaggtaaaataaccttggaactgttgagaacccgcaaacggtttgtttat
gccgaccctcctttactccctgaaaccatgacatcagtgctcgccgcgatcgcactggga
agcaatctgggtgactctccccggattttgtcagaggcgatcgctcatttagattccacc
ccagggatatcggtacagcagacctcacgctggtatcaaaccgcagcgatcggccctccg
caacctgattatctcaatggctgtgctttaatgcaagtccaactcaccccccaccagttg
ctagagcgtttattagagattgaaactcaattcggacggatccgccgggaacggtgggga
ccgagaactctagacctagatttactcttctatgatgatacaattgtggcgacacccaca
ttggaagtaccgcatcctaggatgagagaacgagcctttgtcctagtgcctttagcggaa
gtcgcccccgactgggtggatccagtctccggtgaggcagtcaggcaacttctgcaacgc
ctagatattagtggggtccaaaccctgtacaattga

DBGET integrated database retrieval system