KEGG   Oscillatoria acuminata: Oscil6304_3461Help
Entry
Oscil6304_3461    CDS       T02368                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
oac  Oscillatoria acuminata
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Oscil6304_3461
DNA repair and recombination proteins [BR:oac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Oscil6304_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4327993..4328592
Genome map
AA seq 199 aa AA seqDB search
MTVYTRPLARLIEQLQRLPGIGPKSAQRLALHLLKRPDDEIQALAKALVDAKQQVGFCKE
CFHLSAEPICEICRAPNRDRDVICVVSDSRDLIALEKTREFRGKYHVLGGVISPMDGIGP
EQLNIQALVRRVSQQQIKEVIIAISPSVEGETTTLYVGQLLKPFTRVTRIAFGLPMGGDL
EYADEVTLARALEGRRDLD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ctgaccgtttatactcgtcctttagctcgtttaatcgagcaactgcaacgtttgccagga
attggccctaaatccgcccaaagactggcccttcatttattgaagcgacccgatgatgaa
attcaggcattggcgaaggcgttagttgatgccaaacaacaagtgggattttgtaaggag
tgttttcacttgagtgcagaacccatttgcgaaatctgtcgtgcaccgaatcgcgatcgc
gatgtgatttgcgtggtttccgactctcgggacttaattgctttagaaaaaacccgggaa
tttagaggcaaatatcatgtcctcggtggggtaatttcgcctatggatggcattggacct
gaacaactgaatatccaagcattagtccggcgcgtgagtcaacaacaaatcaaagaagtg
attatcgccattagtcccagcgtcgagggagaaaccaccaccctttatgtgggacaatta
ctcaaaccttttacccgagtcacgcgcattgcttttggattgccaatgggaggagatttg
gaatatgccgatgaagtcaccttagcgcgtgccttggagggtcgtcgagatttagactag

DBGET integrated database retrieval system