KEGG   Oscillatoria acuminata: Oscil6304_3550Help
Entry
Oscil6304_3550    CDS       T02368                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
oac  Oscillatoria acuminata
Brite
Enzymes [BR:oac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Oscil6304_3550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4457272..4457880
Genome map
AA seq 202 aa AA seqDB search
MIDLYTFPTPNGRKVSILLEELEISYNVHKVDITKGEQFSPDFVEINPNSKIPAIIDNES
EMTIFESGAILMYLAEKTGKLLPRETKSRYQVMEWLMFQMASVGPMFGQFNHFNRFAPEK
VPYAIARYEQETLRLYGVLDRQLADRLYIAGEDYSIADIALFPWVASYEFMGLTLEKHPH
LKRWVELLQQRPAVQRGMAVPA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctctatacctttccgactcccaatggacgtaaagtttctattctgttagaa
gagttagagatttcctacaatgtccataaggttgatattaccaaaggggagcaattttcc
ccagattttgttgagattaatcccaatagtaaaattccggcaattatcgataatgagtca
gagatgacgatatttgaatccggtgctattttaatgtatctggcggaaaaaacgggaaaa
ttgctgccccgggagactaaatctcggtatcaagtcatggaatggttgatgtttcagatg
gcgagtgtgggtccgatgtttgggcagtttaatcattttaatcggtttgcgccggaaaaa
gttccttatgcgatcgcccggtatgagcaagaaactttacgattatatggggtattagat
agacaattggccgatcgcctctatattgcgggggaggattactccattgcggatattgcg
ctttttccttgggtggcgagttacgagtttatggggttgactttagaaaaacatccccat
ctaaagcgctgggtagaattactacagcaacgtccggcagtacaacgggggatggcagtc
cctgcataa

DBGET integrated database retrieval system