KEGG   Oscillatoria acuminata: Oscil6304_3671Help
Entry
Oscil6304_3671    CDS       T02368                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
oac  Oscillatoria acuminata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:oac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4640832..4644554)
Genome map
AA seq 1240 aa AA seqDB search
MKRIVLIAGFESFNADLYRQAAQVAIARCPELGIRVFSDKDLTAKPEEVATALKQADVFF
ASLIFDYDCVMGLREKVQEIPIRLVFESALELMSLTQLGKFAIGDKPKGMPKPVQFILSK
FSSGREEDKLAGYISFLKTGPKLLKYVPVQKVQDLRNWLIIYGYWNAGGAENVAAMCWTL
AEKYLGLTVGEIPPPVETPNMGLLHPNYSGYFESPRQYLDWYRTQHLSLNNPVVGILLYR
KHVITQQPYIPQLIKQFEEAGLIPLPIFINGVEGHVAVRDWMTSADETRQRQQGNNLTRS
LSSEAVEVDAIVSTIGFPLVGGPAGSMEAGRQIEVAKGILAAKNLPYFIAAPLLIQDIHS
WTRQGIGGLQSVVLYALPELDGAIDTVPLGGLVGEDIYLIPERVKRLTGRIKSWIELRKA
PPANRKIAIIVYGFPPGYGATGTAALLNVPRSLLNFLQSLKDNGYTVGDLPEDGEELIQR
VKVADESPVETKLTRSQGIIPTKVNIKTLDKWLGYLLTRRIEKQWKSFRDTGIKTYGDDY
AIGGIRLGNIWIGVQPPLGISGDPIRLMFERDMTPHPQYAAFYKWLQHDFKAQALVHFGM
HGTVEWLPGSPLGNTGYSWPDILLGNLPNLYIYAANNPSESILAKRRGYGVLISHNVPPY
GRAGLYKEMVLLRELIGEYREDPGKNSALREAIAQKIVDIGLDMDCPFTEAKKLGIDFTP
ETARMFSPEVLNPYFITIYDYLQVVEQRLFSSGLHTLGEPPNISALKSYLDAYFDQNFDE
ELVEELATGNSPESLSQLIQNPDEAVQICQLLKQTPDEMTNLLRGLNGEYIPPAPGGDLL
RDGPGVLPTGRNIHALDPYRMPSPAAYSRGQEIAKKIIAQHQQETGQYPETVAVMLWGLD
IIKTRGESLAILLELVGAKPIKEGTGRIVRYELQPLDQVGHPRIDILANLSGIFRDSFVN
IIELLDDLFLRATEADEPEDQNFIRKHALALKSQGIENVSARLFSNPAGDFGSLVNDQVI
ESNWESGDELAQTWQSRNAFSYGRKDKGKARPEVLQQLLKTSDRIIQEIDSVEYGLTDIQ
EYYANTGGLKRAAETQSGKKVTASLIESFSKDTTPRKLEDLLRLEYRTKLLNPKWAESMA
NQGSGGAYEISQRMTALIGWGGTVDFKDNWVYDGASETYAFDPEMANKLRKANPEAFRNI
VGRMLEAHGRGFWNPDPDKLEKLQALYSVTEDEIEGVAME
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgttttaattgcaggatttgaatcgtttaacgctgacttgtaccggcaa
gcagcacaggtggcaattgcgcgctgtcctgagttgggtattcgagtctttagtgacaaa
gacctcaccgccaaacccgaggaagtagcaaccgcacttaaacaggcagatgtatttttt
gctagtttgatttttgactatgattgcgtcatgggattgcgggaaaaagtccaggagatt
cccattcgtttggtattcgagtctgccttggaattgatgagtttaactcagttaggaaaa
tttgcgatcggggacaaacccaaaggaatgccaaaacctgtgcaattcattctgagtaag
ttttccagtggccgagaagaagataaactcgccggatatattagttttctcaaaactgga
cccaaactgctcaaatatgtcccggtgcaaaaagttcaggacctccgcaattggttaatt
atttatggatattggaatgccggaggtgcagagaatgtcgccgccatgtgttggacttta
gcggaaaaatatctcgggttaaccgttggtgaaattcctcctccggtcgagactcctaat
atgggattactccatcctaactattccggatattttgaatcaccccgccaatatttagac
tggtatcgaacccaacatttatccttgaataatcccgttgtgggaatccttctctatcgc
aagcacgttattactcagcaaccttacattccccaattaattaaacagtttgaagaagcg
ggattaattccgctgccgatttttattaatggcgttgagggtcatgtggcagttcgggat
tggatgacttccgcagatgaaacccgtcagcgacagcagggaaacaatttaacgcggtcc
ttatcttctgaagcagtcgaagtggatgccattgtttctaccattggatttcccttagtt
ggaggtccggcgggttcaatggaagcaggacggcaaattgaagtcgcaaaaggtattcta
gcggctaagaatctcccttattttatcgcagccccgttattaattcaagatatccattcc
tggactcgccaagggattggtggattgcaaagtgtggttttatatgctttacccgaactc
gatggggcgatcgataccgttcccctcggtggtttagtcggggaagatatctatttaatt
cctgaacgagtaaagcgcctcacaggacggattaaatcttggattgaactgcgaaaagcg
cccccagcaaaccgcaaaattgcgattattgtatatggatttcccccgggttatggcgca
acgggaaccgctgctttactgaatgtcccccgcagtctcctcaacttcctacaatccctc
aaagataacggttacaccgtgggggatttacccgaggatggggaagaattaatccagcgg
gtcaaggtggccgatgagtcacctgtagagacaaaattaacgcgatcgcaaggcatcatt
ccgactaaagtcaatattaaaaccctggataaatggttgggatatctcctcacccgacgg
attgagaagcaatggaaatctttcagggataccggcattaaaacttacggggatgactat
gcgatcgggggaattcgtttgggcaatatttggattggagtccaaccacccctgggcatt
tctggcgacccaatacggttaatgtttgaacgggatatgacccctcatcctcagtatgcc
gccttctataaatggctgcaacatgattttaaagcccaggcattggttcattttggaatg
catggcaccgtggaatggttgccggggtctcccttgggaaataccggatattcttggccg
gatattctgttgggaaatctgcctaatctctatatttatgcagcaaataatccctcagag
tcaatattagccaaacggagagggtatggggtgttaatttctcataatgtgccgccttat
ggtcgggcgggattgtacaaagaaatggtattgctgcgggaattgattggggaatatcga
gaagaccctgggaaaaattcggcgttgcgggaggcgatcgcccaaaaaattgtcgatatt
ggcctagacatggactgtccctttaccgaagccaaaaaattaggcattgacttcaccccg
gaaacagccagaatgtttagtcccgaggtattaaacccctattttatcaccatttatgac
tatttacaagtcgtcgaacaacggttattttcctccggactgcataccctgggagaacct
cccaatatatcggcattaaagtcttatctggatgcctattttgaccaaaactttgacgaa
gaacttgtagaggaactcgccaccggcaacagccccgaatccctctctcaactcattcaa
aatcccgatgaagcggtgcaaatttgtcaattattaaaacaaacacctgacgaaatgacc
aacctgttacgcggattaaatggggaatatattccccctgcacctggtggggatttattg
cgcgatggaccgggagttttacccacgggacggaatattcatgccttagacccctatcga
atgccctcccctgccgcctacagccgagggcaagaaattgccaaaaaaattatcgcccaa
catcagcaagaaaccgggcaatatcctgaaactgtggcggtgatgttatggggattagac
attatcaaaacccggggcgaatctttagccattttgttagaattagtcggcgcaaaacct
atcaaagaaggcactggacggattgttcgctatgaactccaacccctagaccaagtagga
catccacgcatcgatattttagccaatttatccggcatctttcgcgatagcttcgtcaac
attattgaactgttggatgatttatttttacgcgctacagaagcagatgaacccgaagac
caaaattttatccgcaaacacgctttagcgttaaaatcccagggaatcgagaatgtttcc
gcccgcttattttctaaccctgccggagattttgggtctttagtcaatgaccaagttatc
gaaagtaactgggaatccggggatgaattagcgcaaacttggcaaagtcgaaacgccttt
agttacggacggaaagataaaggcaaagcgcgtccagaggtgttgcaacagttacttaaa
accagcgatcgcatcatccaagaaatcgattccgtcgaatatggactcaccgacatccag
gaatattatgccaacactggcggattaaaacgcgctgctgaaactcaaagcggcaaaaaa
gttaccgccagcttaattgaaagtttctccaaagataccactccccgcaaattagaagac
ctcttacgcttagaatatcgcaccaaactcctcaatcccaaatgggccgaatcaatggcc
aatcaagggtctggtggcgcttatgaaatctcccaacggatgactgccttaatcggatgg
ggaggaaccgttgattttaaagataattgggtgtatgatggcgcatcagaaacctacgct
tttgacccagaaatggcaaataaactgcgaaaagccaatcctgaagcgttccgcaatatt
gtcggcagaatgctagaagcgcatggacggggattctggaatccagacccggataagcta
gaaaaactgcaagcattgtacagtgtaaccgaggatgaaatcgaaggcgtggcaatggaa
taa

DBGET integrated database retrieval system