KEGG   Oscillatoria acuminata: Oscil6304_3696Help
Entry
Oscil6304_3696    CDS       T02368                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
oac  Oscillatoria acuminata
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:oac00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:oac00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4681451..4682944)
Genome map
AA seq 497 aa AA seqDB search
MKLKALLPSILLETLDKEALEIEVTGLSTNSHGCKPGDLFIGMPGTRVDGGDFWPSAIAA
GAVAALVSPQAAQKHPPQSDAVVIPVADMTAACAQVAAAFYGEPGKKLNLIGITGTNGKT
TTTHLVEFILQKVQKPTALLGTLYVRWPGFEQVAAHTTPFAVDLNHQLSDAVQAGCEFGV
MEVSSHSLAQGRVQGLPFQVGIFTNLTQDHLDFHATMEDYFEAKAKLFSAEYLQGCAVVN
IDDSYGQRLAERLSGDKLWGYSTHNSQADLWTSDIEYEPAGVKGMLHTPVGNAKFSLPLV
GQYNVENMLAAVGAALHFGIPLAEIVAVLPEFPGVPGRMEQVLIKPDQDISAIVDYAHTP
DSLENVLKATRPFISGKLICVFGCGGDRDRTKRPIMGKIAAELADVVVVTSDNPRTEDPE
QILKDVAAGIPQSISARVIGDRAIAIRTAILEAKPGDGVVIAGKGHEDYQILGTEKIHFD
DREQAREALNQRFAAVV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaagcgttattacccagcattctgttagagacccttgacaaggaagcgctg
gaaatcgaggtcacgggtttaagtaccaattctcatgggtgcaaacctggggatctcttt
attggaatgccgggaacccgggtagatggcggtgatttttggccctcggcgatcgcagcc
ggtgcggtggcagccttagtcagtcctcaagcggcgcaaaaacacccaccccaatctgat
gccgtggtgattcccgtggcagatatgaccgctgcctgtgcccaggtagccgcagccttt
tatggggaaccggggaaaaaactcaatttaattgggataaccgggaccaatggcaaaacg
acaacgactcatttagtggagtttattctccagaaggtccaaaaacccacggcgctatta
gggaccctgtatgtccggtggccgggatttgaacaggtggcggcccatacgaccccgttt
gcggtggacttgaatcatcagttaagtgatgcagtccaggcgggatgcgaatttggggtg
atggaagtcagttcccattccttggcccagggacgggtgcaggggttgccgtttcaagtc
gggatttttacgaatttgacccaggaccacctcgatttccatgcaacgatggaggattac
ttcgaggccaaagccaagctgttcagtgccgaatatttgcaaggttgcgcggtggtgaat
attgatgatagctatggacaacgcttggcggaacggttgagtggggataagttgtggggt
tatagcacccacaattcccaggcggatttatggaccagtgatattgagtatgaaccggca
ggggtgaagggaatgctacatacgccggtgggtaatgccaagttttctttgcccttggtg
ggacaatacaatgtagaaaatatgctggcggcagtgggggcggccctgcattttgggatt
ccgttggcggagattgtggcagtgttgccggagtttccgggagtgccaggacggatggaa
caggtgctgattaagccggaccaggatattagcgcgatcgtggattatgctcatacgccg
gatagtttggaaaatgtgctgaaggcgacgcgaccttttatttcggggaaattaatttgt
gtgtttgggtgcgggggcgatcgcgatcgcaccaaacgtccgattatgggtaaaattgcg
gcagaattggccgatgtagtggtggtgacttcggataatcctcggactgaagacccggaa
cagattttaaaggatgtggcggcagggattcctcagagtatttcagcgcgagtgattggc
gatcgcgcgatcgcaattcggaccgccatcctggaagcaaaacccggtgatggggtggtg
attgccggtaagggccatgaagattatcaaattctcgggacagaaaaaatccattttgat
gaccgagaacaagcgcgggaggcgttaaatcaacggtttgccgctgtggtttaa

DBGET integrated database retrieval system