KEGG   Oscillatoria acuminata: Oscil6304_3832Help
Entry
Oscil6304_3832    CDS       T02368                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
oac  Oscillatoria acuminata
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oscil6304_3832
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oscil6304_3832
   00052 Galactose metabolism
    Oscil6304_3832
   00500 Starch and sucrose metabolism
    Oscil6304_3832
   00520 Amino sugar and nucleotide sugar metabolism
    Oscil6304_3832
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Oscil6304_3832
   00524 Butirosin and neomycin biosynthesis
    Oscil6304_3832
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Oscil6304_3832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4838695..4839603)
Genome map
AA seq 302 aa AA seqDB search
MTNDNTPFVIGIDLGGTAIKLGRFEFDGTCNESWSVDTPKPATPEAVLQVLVEAIAQVDP
ENQCRAVGVGTPGPVDATGQIAKVAINLDGWQDVPLGSWLSQKTGKPVILANDANCAGLG
ESWLGSGRQFRNLILLTLGTGVGGAIILDGKLFTGHTGAAGELGLITINLYGPECNSGNK
GSLEQYASVQAIQRATRTTPEEMGHAARSGNRQALEFWEGYGHHLGAGLASLIYVLTPEA
VIIGGGISASAEFFLPGAIAEIERRVLPVCRPNLQVLVAELGNKAGMVGAAKLAWQTIED
SL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgacaataccccctttgtcataggaattgatttaggtgggactgcgattaaa
ttaggacgatttgagttcgatgggacctgtaatgaatcttggtctgtcgataccccgaaa
cccgcgacaccagaggcagtcttacaagtgctagtggaagccattgctcaagtggaccca
gagaaccaatgtcgggcagtcggggtggggacaccgggtccggtggatgccacgggtcag
attgccaaagttgccattaatttggatggatggcaggatgtccccctgggttcatggtta
tcgcaaaaaacgggcaaacccgtgattctcgccaatgatgccaactgtgccggattggga
gaatcatggttagggtccgggcgtcagtttcgcaatctgattttgctcaccctggggact
ggggttggcggtgcaattatcctggatgggaagttgtttaccggccatactggggcagcc
ggggagttaggattaattacgattaatttgtatggtcctgagtgtaatagtgggaataaa
ggctcgttagagcagtatgcttcagtgcaagcgattcaacgggcgactcggacgactcca
gaagaaatgggtcatgcggcgcgatcgggcaaccggcaggcgttggagttttgggaaggg
tatggacatcatttgggggctggattagccagtttaatttatgtgttgaccccagaggca
gtcataattggcggtggaattagtgcgagtgcagaattttttcttccaggggcgatcgca
gaaattgaacgccgagtcctgccggtttgtcggcccaatttgcaggttttagtcgctgaa
ttaggcaacaaagccggtatggtgggtgcagctaaattagcatggcaaaccatagaagat
agcctttag

DBGET integrated database retrieval system