KEGG   Oscillatoria acuminata: Oscil6304_3906Help
Entry
Oscil6304_3906    CDS       T02368                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
oac  Oscillatoria acuminata
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oscil6304_3906
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oscil6304_3906
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Oscil6304_3906
Enzymes [BR:oac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Oscil6304_3906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4948501..4949628)
Genome map
AA seq 375 aa AA seqDB search
MTLSYSPVPSPTPGATPADAPLRSSYWPGLIEAYRQYLPVSDQTPVVTLQEGNTPLIPAP
AIAEIIGRQVQVYVKYDGLNPTGSFKDRGMTMAISKAKEDGAKAVICASTGNTSASAAAY
ARRAGMRAFVLIPDGYVALGKLAQALLYGAEVLAIKGNFDKALEIVRDMAEHYPVTLVNS
VNPYRLEGQKTGAFEVVDALGNAPDWLCIPVGNAGNISAYWMGFCQYHQAGKCDRLPQMM
GFQAAGAAPLVHGQPVANPETLATAIRIGNPASWDKAIAAQESSGGSFNAVTDDEILDAY
RLLASREGVFCEPASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSNNPFKQ
GIEPEIEAVAKVMGF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgagttattctcccgttccctccccaactcccggtgcaactccagcagatgcc
ccccttcggtcctcatactggcccggtctcattgaggcttaccggcagtatctgcccgtc
agcgaccagactccagtcgttaccctccaagaaggtaacacccccctaattcccgccccg
gcgatcgccgagatcatcggcagacaggtgcaagtttacgtcaaatatgacggtctcaac
cccaccggcagctttaaagaccgggggatgacgatggctatttccaaagccaaagaagac
ggggccaaagccgtcatttgtgccagtaccggcaacacctccgcctccgctgcggcctat
gctagacgcgccggaatgcgggcatttgtcctgattcccgatggttatgtcgccctaggc
aaactggcccaagccttactctatggtgcagaagtcttagccattaaaggaaatttcgac
aaagccctagaaattgtccgggatatggccgaacattatcccgttaccttggtcaactcc
gtcaatccctatcgcctcgaagggcagaaaactggagcatttgaggtggtggatgccttg
ggtaatgcccccgattggttgtgcattcctgtgggtaatgcgggcaatatttccgcctat
tggatgggattttgtcagtaccatcaagcgggtaaatgcgatcgcctgccgcaaatgatg
ggctttcaagccgctggtgcagcccccctcgtccacggtcaacctgtcgcgaatcccgaa
accctcgccaccgccatccgcatcggcaatcccgccagttgggataaggcgatcgccgcc
caagagtcctctggaggcagttttaacgccgtcaccgatgacgaaattctcgatgcctat
cgtcttttagcttcccgagaaggggtattctgcgaacccgcctccgctgcctccgttgcg
ggattactcaaggtcaaagaccaagtacccactggggccaccgtcgtttgcgtcctcacc
ggcaatggactcaaagacccggatactgcgattaaacatagcaacaatccctttaaacaa
ggaattgaaccggaaatcgaagcagtggcaaaagtgatgggattttag

DBGET integrated database retrieval system