KEGG   Oscillatoria acuminata: Oscil6304_4193Help
Entry
Oscil6304_4193    CDS       T02368                                 

Definition
(GenBank) chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
oac  Oscillatoria acuminata
Pathway
oac02020  Two-component system
oac02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:oac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Oscil6304_4193
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Oscil6304_4193
Enzymes [BR:oac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Oscil6304_4193
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Oscil6304_4193
Two-component system [BR:oac02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Oscil6304_4193
Bacterial motility proteins [BR:oac02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Oscil6304_4193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AFY83722
UniProt: K9TLH7
Position
complement(5343809..5344855)
Genome map
AA seq 348 aa AA seqDB search
MNKIVRVLVVDDSAYVRKVVKQMLSRSPFIEVVGTSRDGAEALEAIATLNPDVVTLDLIM
PEMDGVEFLRQQMARRPIPVVIISIASEGGEQVLAALDAGAVDFLQKPTALANEKIFEIS
NELIEKVKAAANVPLNRLPVMSERPIQLSKMVPSSPPSGVVDLVAIGISTGGPQALAFLI
GQLPADLPVPVAIVLHMPVGYTAMYAKRLNEMSLMKVVEASEGDLLQPGVVFIASAGRHL
SFVRHSDGTVRTHLDARPFDTLHRPSVDVMFQSAAEVFGDRVLGVVMTGMGSDGTQGSAW
IKSRGGSIFTEAEESCIVYGMPRSVVEAGLSDRSIPLNGMAQAILNRL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaattgtacgagttttggtagtagatgattcagcttatgtccgtaaggtagtc
aagcaaatgctatcccgttctccatttattgaagtggtaggaacgtcccgagacggagcg
gaagcattggaggcgatcgccaccctaaaccccgatgtggttactttagacttgatcatg
ccggaaatggacggagtggaatttttgcgccaacaaatggcccgtcgtcctattcccgtg
gtgattattagtattgccagtgaagggggggaacaggtcctcgcggcattggatgctggg
gcggttgacttcttacaaaagccgacggcattggcgaatgaaaagatttttgagatcagc
aatgagttgattgaaaaggtgaaagctgctgccaatgttcccctcaaccgcctgccggtg
atgtcggaacgtccgattcaattgagcaagatggtgccttcctccccgccatccggggtt
gtggaccttgtggcaatcgggatttctaccgggggtccccaggccctagcttttttaatt
ggtcagttgccggcagatttacccgtcccggtggcgatcgtcttacatatgcccgtgggt
tataccgcgatgtatgcaaaacgactcaatgagatgtcgttgatgaaggttgtagaagcc
tcggaaggggacctgctccaacctggggttgtgttcatcgcctctgccggacggcattta
tcgtttgttcgccatagtgatggcaccgtgaggacacacctggatgctcgtcccttcgat
acgctccatcgtccttcggtggatgtgatgtttcaatctgccgcagaggtgtttggcgat
cgcgttttgggggtagtgatgacggggatggggtccgatggcactcaaggttcggcttgg
attaaatctcgtggcggctccatttttacggaagcggaggaaagctgtatcgtctacgga
atgccgcgatcggttgtcgaagcgggcttaagtgaccgctctatacccttaaatggcatg
gcacaggcgattcttaaccggctgtaa

DBGET integrated database retrieval system