KEGG   Oscillatoria acuminata: Oscil6304_4442Help
Entry
Oscil6304_4442    CDS       T02368                                 

Definition
PAS domain-containing protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
oac  Oscillatoria acuminata
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:oac02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:oac02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5704026..5705870)
Genome map
AA seq 614 aa AA seqDB search
MTANDQTSIFEALLEYLRQSRGFDFVGYKRSSLQRRVTKRMQVHQIDNFGDYLEYLKVHP
EEFPALFNTILINVTSFFRDLTAWKYLASHTLPQIIKHKSPEEPLRFWTAGCASGEEAYT
LAILLVETLGIEDCLRRVKIYATDVDEEALTQARNATYKAKDIESISEEFQQRYFRRVGD
RFGLDGDLRRLVIFGRHDLIHDAPISRLDLLICRNTLMYFNAETQKRVLARFHFSLKDTG
FVFLGKAEMLLTHSDLFSPLNLQHRIFQKVRKMDRRDRLLVLAQNRTEEAGRRSTLNIRL
LEAAFNAIPLAQIIVDSDSNLVLANQLARSRFGIDRQDLGRRFQDLEISYRPVELRSQIE
RVYKEGNSILVSDVIRTWSDGSVQYLDIEISPLQQNTSAPLGVSITFNEVTRYHQLQEQL
ERSNQELETVNEELQSSNEELETTNEELQSSHEELETTNEELQSTNEELETMNEELQSSN
EELQTINDDLGQKTIELNQCNVFLESIFASLQSAVIVVDRQFQIQTWNEAAQNLWGPKAD
EVQKQSLFNLDIGLPVERLRDPLYQCLSGTQPGQEILIDALNRQGGSIQCRLSFNPLKDG
SKEPHGVILLIKEV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaatgatcagacttcaatatttgaagcacttctagagtatctgcgccaatcg
cgcggctttgattttgttggatataagcgctcctccctccagcgtcgagtcaccaagcga
atgcaggtgcatcagattgacaactttggggattacctggaatacttgaaagttcaccca
gaagaattccccgccttattcaacaccatcttaattaacgttactagcttttttcgagat
ctcacggcatggaaatacttagcctcccataccctgccgcagattatcaaacacaaatcc
ccagaagaacccctacgcttctggactgcgggttgtgcctcgggagaagaagcctacacc
ttggcgattttactcgtagaaaccctcggcattgaagactgtctgcgacgggtgaaaatt
tacgccaccgatgtagatgaggaagccttgacacaggcacggaatgccacctataaagcc
aaagatatcgagtctatctcggaggaattccagcagcgatactttaggcgggtcggcgat
cgcttcggattggatggggatctgcgtcggctagtcatctttggtcgtcatgacttgatt
catgatgctcccatttctcgcctggatttgctgatatgccgcaacaccctgatgtatttt
aatgcagaaacccaaaagcgggttctggctcgctttcatttttcactcaaagatacgggc
tttgtatttttgggtaaagccgaaatgctactcactcacagcgatctgtttagtccctta
aacttacagcaccggatctttcagaaagtgcgaaaaatggaccggcgcgatcgcctttta
gtcttagcgcagaatagaacagaagaagccgggaggcgatcgactttaaatatccgcctg
ttggaggccgcttttaatgcgatccctctggcgcaaattatagtagactctgacagcaat
ctcgtcctagccaatcagttagctcggtcccgttttggcattgaccgtcaggacctggga
cgacggttccaggatttagaaatttcttaccgtcccgtggagttgcgatcgcagattgaa
cgggtctacaaagaaggcaactcgattctcgtcagcgatgtgatccgcacttggagcgat
ggcagcgttcagtatttggatatcgaaatctccccgttacagcaaaataccagcgctccc
ctcggcgtgagtatcacgtttaacgaagtcactcgctatcaccagttacaagagcaactg
gaacggtctaaccaggaactcgaaacggtgaatgaggaactccagtccagcaatgaggaa
ctggagacgactaacgaggaactccagtccagccatgaagaactggagacgaccaatgaa
gaactccagtctaccaatgaagaactagagacgatgaatgaggaacttcaatccagcaat
gaggaacttcaaactatcaatgatgacctcgggcaaaaaaccatagaactgaatcaatgt
aatgtttttttagagtctatttttgctagtctgcaatcagcggtgattgtggtagaccgt
caattccaaattcaaacttggaacgaagcggcccaaaatctctggggaccaaaagcggat
gaagtgcagaaacaatctctctttaacctggatattggcttacctgtggaacgtctgcgc
gaccccctttatcaatgcttgagtggcacacaaccgggtcaagaaatcctcatcgatgct
ttgaatcgtcagggtgggtcgattcagtgccgcctgagctttaatccacttaaagatggg
agcaaagaacctcatggggtgattcttttaatcaaggaagtttaa

DBGET integrated database retrieval system