KEGG   Oscillatoria acuminata: Oscil6304_4708Help
Entry
Oscil6304_4708    CDS       T02368                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
oac  Oscillatoria acuminata
Pathway
oac00330  Arginine and proline metabolism
oac00332  Carbapenem biosynthesis
oac01100  Metabolic pathways
oac01130  Biosynthesis of antibiotics
oac01230  Biosynthesis of amino acids
Module
oac_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Oscil6304_4708
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Oscil6304_4708
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Oscil6304_4708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SelB-wing_1
Motif
Other DBs
NCBI-ProteinID: AFY84219
UniProt: K9TQD5
Position
6013212..6014372
Genome map
AA seq 386 aa AA seqDB search
MNLQTLVVKIGTSSLTQNSTGNLAIATIAALVETLTALRHQGHRVILVSSGAVGVGCARL
GLKERPRTIALKQAVAAVGQGRLMRVYDDLFTTLQQPIAQVLLTRSDLVQRSRYVNAYNT
FQELLRLGVIPIVNENDTVAIEELKFGDNDTLSAMVASLVEAEWLFLMTDVDRLYSADPR
SNPDAQPITLVQHLDELRQLQVETGGSGSNWGTGGMMTKIEAARIATSAGVRTVITSSQS
PRNLEKILQGEAIGTHFAPQKSTSNARKRWLANAVIPSGKLYLDEGAVRAICQGGKSLLA
AGILEVFGEFEPSDAVQLCDRSGREIARGLVNYSSDELDRIRGRKSDEIPEILGYIVADT
VIHRDNLVLSGSSSDAPELNNTDPLH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcaaaccctagtcgtcaaaattggtacctctagtctcacccagaacagcact
ggcaacctggcgatcgccaccattgcggccctcgttgaaaccctcaccgccctccggcac
caagggcaccgcgttatcttagtctcctccggtgccgtcggggtcggctgtgcccgtcta
ggattaaaagagcgtccccggacgatcgccctcaaacaggcggtggcagcagtcggtcag
ggccgcttaatgcgggtatatgatgacctgtttaccactctgcaacagccgatcgcccaa
gtcctcctcacccgcagcgatttagtccaacgcagtcgctacgtcaacgcttacaatact
ttccaagaattactgcgcctcggggtcattccgattgtcaacgaaaatgatacggtagcg
atcgaagaactcaaattcggcgacaatgataccctctcggcaatggttgccagcttagtc
gaagccgaatggctgtttctgatgaccgatgtcgatcgcctctactccgccgacccccgc
agcaatcctgacgcccaaccgattaccctggttcaacatctcgatgagttgcggcagtta
caggtggaaaccggaggcagtggcagcaattgggggacggggggaatgatgacgaaaatt
gaggcggcccgcattgccaccagtgccggagtccgcacggtgattacctcgtctcaatct
ccgcgcaacttggagaagattttgcagggggaggcgatcggcacccattttgcaccgcaa
aagagcaccagtaacgcccgcaagcgctggctggccaatgcggtcattccttccggtaaa
ctttatttagatgaaggggccgtccgagcaatctgtcaaggggggaaatctcttttagcc
gcaggcatcctggaggtgttcggagaatttgagccgtcggatgcggtgcaactgtgcgat
cgctcgggtcgggaaattgcccggggactggtcaactatagcagtgacgaactcgatcgc
attcgcggacgaaaatctgatgaaattcccgaaattttaggttatattgttgccgacacg
gtaatccaccgggataacttagttttaagcggttccagtagtgatgccccagagttgaac
aacaccgaccccctgcactga

DBGET integrated database retrieval system