KEGG   Oscillatoria acuminata: Oscil6304_5050Help
Entry
Oscil6304_5050    CDS       T02368                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
oac  Oscillatoria acuminata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Oscil6304_5050
Enzymes [BR:oac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Oscil6304_5050
Exosome [BR:oac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Oscil6304_5050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6440432..6442093
Genome map
AA seq 553 aa AA seqDB search
MANAIEFKLFAPYNKGAALIGSFSKWENIPMEKDDQGYFRTSVNLEDGVYEYKFRVQTKT
EYLDPDSWVYAIDPYAKEIDKTGQNGIIRIKEGEPIVDTYVWQHDQVPLPSNGELVIYEM
LVGNFCGQKEDREQGSFEAAITKLDYLADLGINAIELMPVMGGDQGWGYLVQHYFSPAPN
YGSSDELKRLIDECHARGIRVIMDMVFNHSNDDCPLLKIDRDYWYYHYKHYPDDDNNWWG
PEFNYDHHDSNLDIRPAWSFSGDVVRYWIQEYHIDGMRYDALSQLANWEYLHWIANLARE
TAGPKPFYNIGEHIPEKPKYARFEGPMDGCWHESFHYFLVDYICNDDTLDLEQLKEVLDC
KTQGYEDSTNVINYLSNHDQSRILNLLGDRGIFDDHAFRRTKLGAAILMTTVGIPMLWMG
QEFGQDSCEHPNQSCELKWYLLDNERNRSLFDYYKGLIALRKQNHAIQSENIEFIHENPE
EQVIAYIRWNEEGSRVVVVANFSGNFLGGYTIPDFPDNGKWHEWTRNYDIESQDNQLVLD
LGEYEAQVFVWNS
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgcgattgaatttaagttgtttgcaccctataataaaggggccgcactgatc
ggctcgttttccaaatgggaaaacattccgatggaaaaagacgaccagggttattttcgc
acttcagtcaacctcgaagatggagtgtatgagtataaattccgagttcagactaaaacc
gaatatttagacccggattcctgggtatatgcgatcgacccttatgccaaggaaattgat
aaaaccggccaaaatgggattatccgcattaaagagggggaaccaattgttgatacttat
gtttggcagcatgaccaagttcccttaccgagtaatggggagttagtcatctatgaaatg
ctggtgggtaacttttgtggtcagaaagaggaccgagaacaaggaagttttgaagcagcg
atcactaaattagattacttagcagatttggggattaatgcgatcgagttaatgcccgtc
atgggaggagaccaaggctggggttatctcgtccagcactatttttcccccgcccctaat
tacggttcctctgacgagttgaagcgcctaattgatgaatgtcatgcccgaggaattcgg
gtgattatggacatggtatttaatcattccaatgatgattgcccattattaaaaatagac
cgggattactggtactatcactataagcattatcccgatgatgataacaattggtggggt
ccagaattcaactatgaccatcatgattctaacttagatattcgtcccgcctggtccttt
agcggggatgtggtgcggtactggattcaagaatatcacattgatggaatgcgctatgat
gccttgagtcaactcgccaattgggagtatttacattggattgccaacctagcccgagaa
accgctgggcctaagccgttttataatatcggagaacatatccctgaaaagccgaaatat
gcccgctttgaaggaccgatggatggctgttggcatgaaagttttcactactttttagta
gactatatttgcaatgatgatactttagaccttgagcaactcaaggaagtgctagattgc
aaaacccaggggtatgaagattccaccaatgtgattaattacctctccaatcacgaccag
agtcggatcctaaatttgttaggcgatcggggtatttttgatgatcatgcctttcgccga
actaaattaggggctgctattttaatgaccaccgtcggaattcccatgctgtggatgggc
caagaatttggtcaagatagctgcgaacatcccaaccaaagctgtgaactgaaatggtat
ctcttagacaacgaacgcaaccgcagtttgtttgattattataagggtttaatcgcctta
cgcaagcaaaatcatgccattcaaagtgaaaatatcgagtttatccacgaaaatcccgag
gagcaagtgatcgcttatattcgatggaatgaggaaggttcacgagtcgtcgtcgttgcc
aatttttccggtaattttctcggcggttataccattcccgactttcccgataatgggaaa
tggcacgaatggacgagaaactacgatattgaatctcaggataaccaattagttcttgat
ttgggtgaatatgaagcccaagtctttgtatggaattcgtaa

DBGET integrated database retrieval system