KEGG   Oscillatoria acuminata: Oscil6304_5631Help
Entry
Oscil6304_5631    CDS       T02368                                 

Definition
fatty-acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
oac  Oscillatoria acuminata
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Oscil6304_5631
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Oscil6304_5631
Enzymes [BR:oac01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Oscil6304_5631
Lipid biosynthesis proteins [BR:oac01004]
 Desaturase
  First
   Oscil6304_5631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7203168..7204037
Genome map
AA seq 289 aa AA seqDB search
MTIVSSTQETQETIGQDLSQMRPDWPVIIFMIAIHALALFAFLPSTFSWAAVGLAVLFHW
VTGGLGVTLGFHRLVTHRSFTAPKWLEYFLVLCGTLSCQGSPIDWVGLHRAHHLHSDNSA
DPHDSNQGFWWSHMGWLFYHSPAEAEIPRLTKDIADDPFYQFCDKFLLPIQIALGISFYF
LGEAISPGLGWSFVVWGIFVRLVVVFHCTWFVNSATHKFGYRTYDSEDRSTNCWWVALVT
YGEGWHNNHHAYQYSARHGMQWWEIDFTWMTIQILQALGLAKNVKLVGK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgtcagttcaacacaagaaacacaagaaacaatagggcaagatctgtcccag
atgcggcctgactggccggtgatcatcttcatgatcgcaattcatgctctcgccctcttc
gcattcctgccgagtacctttagttgggcggcagtggggttagcggtcttattccactgg
gtaacggggggtctgggagtcaccctgggatttcatcggttagtcactcaccggagtttt
actgcacccaagtggttagagtattttctggtcctgtgcgggaccctaagctgtcaaggg
agtccgatcgattgggttggactgcatcgtgcacatcatctccactcggataattccgct
gatccccatgactcgaatcaagggttctggtggagccacatgggttggttgttctatcat
tctcccgccgaagccgaaatccctcgcttaacaaaagatattgccgacgatccgttttat
cagttttgcgacaagtttttacttccgattcaaattgctttaggtattagtttctacttt
ttaggagaagccatttccccgggactcggctggtcctttgtggtttggggaatttttgtt
cgcctggtggtggtgtttcactgcacctggtttgtgaacagcgccactcataagtttggc
tatcgcacctatgacagtgaagatcgatccacgaactgctggtgggttgccttagtgacc
tacggcgaaggttggcacaataatcaccatgcgtatcaatattccgctcgacatggaatg
cagtggtgggaaattgattttacttggatgacgattcaaattttacaagcccttggcctt
gcgaagaacgtcaagttagttgggaaataa

DBGET integrated database retrieval system