KEGG   Oscillatoria acuminata: Oscil6304_5879Help
Entry
Oscil6304_5879    CDS       T02368                                 

Definition
fatty-acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
oac  Oscillatoria acuminata
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:oac01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:oac01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7537544..7538395)
Genome map
AA seq 283 aa AA seqDB search
MQLESMPNSPENQSKLNWIITGFFIAIHCLALLAPWCFSWSALGVMLLLHWFLGSIGICL
GYHRLLSHRSFQVPKWLEYTIALIGASALQGGPIFWTAGHRLHHAYTEDEIKDPYSARKG
FWWSHLLWMIYPRPEFFNKELYNRFAPDLARDPFYCWLDRYSLLMQIPLVVVLYLLGGWP
FIVYGVFVRIVLLWHSTWLINSVTHMWGYKTFPTSDNSRNLWWAAIFTYGEGWHNNHHAY
PNVAKAGWRWWELDMTWWAIWVLKTVGLAKKVVMPPTPKANQG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagttagaatcgatgcccaattcaccggaaaatcaatccaaattgaattggataatt
acgggattttttatagccattcattgccttgctttattagcaccctggtgtttttcctgg
tccgcattaggggtaatgttattactacactggtttttagggagtattggcatttgttta
ggctatcatcgcctattgagccatcggagttttcaagttccgaaatggctagaatatacg
atcgccctcatcggtgcatcggcactccaaggcggaccgattttttggactgccggacat
cggttacatcatgcctataccgaagatgaaatcaaagacccttattcggcgcgcaagggc
ttttggtggagtcatctgctgtggatgatttatccccgtcccgaatttttcaacaaggaa
ttgtataaccgattcgctccagacttagcccgagatccgttctactgttggctcgatcgc
tactctttattgatgcaaatccctttagtggttgtcctttatctcttaggcggttggccc
tttatcgtctatggcgtgtttgtgcgaattgtcctgctgtggcatagcacttggctaatt
aactcggttacccatatgtggggatacaaaacctttcccacttcggataattcccggaat
ctctggtgggcggccattttcacctatggcgaaggatggcataataatcatcatgcttat
ccgaatgttgccaaagccggttggcggtggtgggaattggatatgacttggtgggcgatt
tgggttttaaaaaccgtggggttagctaaaaaagtggtgatgcctccgacaccgaaagca
aatcaagggtaa

DBGET integrated database retrieval system