KEGG   Oscillatoria acuminata: Oscil6304_5930Help
Entry
Oscil6304_5930    CDS       T02368                                 

Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
oac  Oscillatoria acuminata
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oscil6304_5930
  Amino acid metabolism
   00340 Histidine metabolism
    Oscil6304_5930
Enzymes [BR:oac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Oscil6304_5930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7595409..7596710
Genome map
AA seq 433 aa AA seqDB search
MLRIITQRAEAQAELRRICDRTHDDQVVHKEATVREVLQAVKRQGDRSLLHYTAEFDGQS
LKPEDLRVSGSELDAAYQQVSKELLDAIGLAKQNIEAFHRQRVPKSWVQFGEDEVVLGKR
YTPVDRAGLYVPGGRAAYPSTVLMNAIPARVAGVPRIVICTPPGPEKTVNPAVLVAAQEA
GIQEIYRVGGAQAIAALAYGTETIPKVDVITGPGNIYVTLAKKQVFGTVGIDSLAGPSEV
LIIADSQGNPAHIATDLLAQAEHDPLAAAILITTDAQIARKVVAQVEDQLIDHPRRTLTE
KAIAHYGVVIVVDSLQIAAELSNEFAPEHLELEVSDPWDLLEYIRHAGAIFLGNSTPEAV
GDYLAGPNHTLPTSGSARYASALGVETFMKHSSLIQYSPKALQKVAGAIDVLTKAEGLPS
HGDSVRKRIKDGP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcattacacagcgggctgaggcacaagctgaactccggcgcatctgcgat
cgcacccacgacgaccaagttgtccataaagaggcaacggttcgagaagtgctccaagcg
gtcaaacgccaaggcgatcgctcactcttgcactatacggctgagttcgacgggcaatcc
ttaaagcccgaagacctgcgcgtgagcggctctgaattggatgccgcctatcagcaggtg
tcaaaagaactcctagatgccattggcttggcaaagcagaacattgaagcgttccatcgt
cagcgggtccccaaatcttgggttcaatttggggaagatgaagtggtgctgggtaaacgt
tataccccggttgatcgagcggggctttacgttccgggggggcgagccgcctaccccagt
accgtgctgatgaatgcaattccggctcgggtggctggggtcccccggattgtgatttgt
acccctccgggaccggaaaaaaccgtgaacccagcggtcctggtggcggcccaggaagcg
ggaatccaggaaatttatcgggtggggggcgctcaggcgatcgctgccctagcttatggt
acggaaaccatccctaaagtggatgtaattaccggcccgggtaatatttatgtcaccctg
gcgaaaaagcaagtctttggcaccgtgggcattgactccttagccggtccctcggaagtc
ctgattattgccgattcccaaggcaatccggctcatatcgccacggatttactggcgcaa
gctgaacatgaccccctcgccgccgccattctgattaccaccgatgctcagattgctcgc
aaggtcgtcgcgcaagtcgaggaccaactgattgatcacccacgccggaccctcaccgaa
aaggcgatcgcccattacggtgtggtcattgtggttgattccctgcaaattgccgccgaa
ctctccaacgaatttgccccagaacacctagaactcgaagtcagcgacccttgggattta
ctggagtatattcgtcatgctggtgccatcttcctcgggaactccacccctgaagctgtc
ggcgattacctcgcaggccctaaccatacccttcccacctcgggatcggctcgttatgcc
tcagctttgggggtggaaacctttatgaaacactccagtttgattcaatattctcccaag
gcactccaaaaggtcgccggtgcgattgatgtgctcacgaaagccgaaggtttaccctct
catggggattcggtccgcaagcgcatcaaagatggcccctag

DBGET integrated database retrieval system