KEGG   Oscillatoria acuminata: Oscil6304_5944Help
Entry
Oscil6304_5944    CDS       T02368                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
oac  Oscillatoria acuminata
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oac00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:oac00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:oac02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7614223..7615866)
Genome map
AA seq 547 aa AA seqDB search
MNRPLKFYDAQQRPWPNSPLEQTSIIGHTTPTTVRLWFRVSEPGEYWLVVSSRPIPTQGI
PLLILGDRREYQLRLTTPTHTEEFFPEIVLPVSFTPETDLTGVMELMNLTPDTRYYYALF
DPNRDSPWELGHEELLWFNTFPEHPKTINFGIYSCHMPYEGRQLANVEMWDRFNEELSKV
NARFVLATGDQVYVDGNAELSIWEWLRKVKSENPTREDMITWYRDIYRGYWGIPEVQRIY
RRFPTYMIWDDHEIVDGWGSYTPDELAGLLDTSWQLRNTQEQLQFADEMFEAARQVYWEY
EHSHNPETDFVNNQFDYGFDCGRCAFYVLDMRGNRNYNREHHRSLGLEQGSRFEKWIANQ
YQSDAEVLFIVSPVPVVHLSSFVINKIDLSLFGYQDDQRDHWEHESNWDERNQLLKWVFQ
FAQETGKRVIFISGDVHIGAAFKLTHSEFPGAKVFQVTSSGIAYAHLKELERKILEMLVK
PEGDLGDRPKNIPYHFENLAVCRYNNFGILRVTEEDSGGMEVCFDLYGGNREESGELSLF
KTSIMLA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccctctaaaattttacgatgctcaacagcgtccttggccgaattcaccctta
gagcaaaccagtattatcggtcatacgacccccaccacggtgcgcctgtggttccgggtt
tctgaaccgggggaatactggttagtggtgtcttctcgtcccattcccactcaggggatt
cctttgttgattttaggcgatcgccgtgaataccagttacgcttgaccactccgactcat
acagaagaatttttcccagaaatcgttctccccgtctcattcaccccagaaaccgacctc
accggcgtcatggaactgatgaatctcacgccggatactcgttattattatgcgttattt
gaccccaaccgggattctccctgggagttgggacatgaggaactcctgtggtttaacacc
tttcccgaacatccgaaaaccatcaattttggcatctatagttgtcatatgccttatgaa
gggcggcagcttgctaatgtggaaatgtgggaccgatttaatgaggaactctccaaggtt
aatgcgcgatttgtgttagcaacgggagatcaagtctatgtggatggcaacgccgagttg
agtatctgggaatggttgcggaaggtcaaatctgagaatccgactcgcgaggatatgatt
acttggtatcgggatatatatcggggatattggggaattccggaagtgcagcgcatttat
cgccgctttccgacttatatgatttgggatgatcatgaaattgtcgatggatgggggtct
tatactcccgatgaactagcgggattgctagatacctcctggcaactgcgaaatacccag
gaacaattgcagtttgccgatgaaatgtttgaagcagcgcgccaggtttattgggaatat
gaacattctcataatcctgagactgattttgtgaataatcagtttgattatggatttgat
tgcggacgctgtgctttttatgtcttagatatgcgcggaaatcgcaattacaatcgcgaa
catcatcgttcattagggttagaacaggggagtcgatttgaaaaatggattgccaatcag
tatcaatccgatgccgaagttttatttattgtgtctcctgttccggtggttcatttaagt
agttttgtgattaacaaaattgacttaagtttgttcggatatcaagatgaccaacgggac
cattgggaacatgaaagcaattgggatgagcgaaatcaattgttaaagtgggtatttcag
tttgcccaagaaaccggcaaacgggtgatttttattagtggggatgttcatattggggca
gcttttaaactcacccattctgagtttcctggggcaaaggtctttcaggtgacttccagt
gggattgcttatgctcatttgaaggaactggaacgaaagattttggagatgttagttaaa
ccggaaggagatttaggcgatcggccaaaaaatattccctatcattttgagaatttggcg
gtctgtcgttataataattttggcattcttagagttacggaagaggactcaggagggatg
gaagtttgctttgatttgtatgggggaaatcgtgaagagagtggggaactttctttgttt
aagacgagtattatgttggcataa

DBGET integrated database retrieval system