KEGG   Oscillatoria acuminata: Oscil6304_6000Help
Entry
Oscil6304_6000    CDS       T02368                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
oac  Oscillatoria acuminata
Pathway
oac00010  Glycolysis / Gluconeogenesis
oac00052  Galactose metabolism
oac00500  Starch and sucrose metabolism
oac00520  Amino sugar and nucleotide sugar metabolism
oac00521  Streptomycin biosynthesis
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01120  Microbial metabolism in diverse environments
oac01130  Biosynthesis of antibiotics
oac01200  Carbon metabolism
Module
oac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oscil6304_6000
   00052 Galactose metabolism
    Oscil6304_6000
   00500 Starch and sucrose metabolism
    Oscil6304_6000
   00520 Amino sugar and nucleotide sugar metabolism
    Oscil6304_6000
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Oscil6304_6000
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Oscil6304_6000
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Oscil6304_6000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFY85462
UniProt: K9TRJ4
Position
7685771..7686790
Genome map
AA seq 339 aa AA seqDB search
MTLLLAGDIGGTKSLLRLVEMPTAADTTSGTIQIDALYEGIYSSQEYPDLVPIVGQFVKE
ASQKLGEVPQPKGACFAIAGPVIGHKSVLTNLSWTLTTDRLEKELNIPHVKLINDFVAVG
YGVLGMNKADLHTLQPGETQTAAPIAVIGAGTGLGQGFLIRHLDEYFVYPSEGGHADFAP
RTAIEFELLQDLRQRENIDRVSVERVVSGMGIASIYQFLRDRAIAAGKDVSPADKDPAEI
SQAALEKSDPICEQTLQIFVEAYGAEAGNLALKLLPYGGLYLAGGIAAKILPLITEGDRF
INSFNHKGRVSPLVEKVPVHIVLNPQVGLIGAAICAARL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccttactattagccggagatatcggtggtaccaaatcccttttgcgcttggtggaa
atgccgacggcagcagatacgacttcagggacgatccagattgacgccctctatgagggg
atttactccagtcaggagtatcctgacttagtacccattgtgggacagtttgtcaaggaa
gcgagtcagaaattaggagaggtcccacaacccaagggggcctgttttgcgatcgctggc
ccggtaatcggacataaatctgtcctaacgaacctgagttggaccctgacaacggaccga
ctcgaaaaagaactcaatattccccatgtcaagttaattaatgactttgtagcagtcggt
tatggcgtgttggggatgaataaagcggacctccataccttacaacctggggaaacgcaa
actgccgccccgatcgccgtgattggcgcaggaactggactgggacaagggtttttaatc
cgccatttggatgaatattttgtctatccctccgaagggggtcatgcagattttgcacct
cgtaccgcgatcgagtttgaattgttgcaagacttacggcaacgggagaacatcgatcgc
gtttctgtggaacgagtagtatcggggatggggattgcgtcaatttatcaatttttgcgc
gatcgggcgatcgctgcgggaaaagatgtttccccggcagacaaagaccccgcagaaatt
tcccaagcggccctagaaaaatctgacccgatctgcgaacaaaccttacaaatttttgtg
gaagcgtatggtgcggaagcgggaaatctggcgttaaaattactaccctacgggggattg
tatctagcggggggaattgccgctaaaattctgcccttaattacagaaggcgatcggttt
atcaacagttttaaccacaaaggtcgagtcagtcccttggtagaaaaagtcccggttcat
atcgttctcaatccccaagtgggattaatcggtgccgccatctgtgctgcccggttatag

DBGET integrated database retrieval system