KEGG   Ochrobactrum anthropi OAB: DR92_4223Help
Entry
DR92_4223         CDS       T03251                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:oah00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR92_4223
   00630 Glyoxylate and dicarboxylate metabolism
    DR92_4223
   00640 Propanoate metabolism
    DR92_4223
   00650 Butanoate metabolism
    DR92_4223
  Lipid metabolism
   00071 Fatty acid degradation
    DR92_4223
   00072 Synthesis and degradation of ketone bodies
    DR92_4223
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR92_4223
   00310 Lysine degradation
    DR92_4223
   00380 Tryptophan metabolism
    DR92_4223
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR92_4223
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR92_4223
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DR92_4223
Enzymes [BR:oah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR92_4223
Exosome [BR:oah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR92_4223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2:1736679..1737887
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSSAFEAGYDFKAPGIQISRFCASGLDAVNLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAAKS
WEKGYFKNSVISIKDQNGLTILDHDEHMRPTTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKMNVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacaccgcgcggacgtggcaagaaggat
ggcagcctgcacgaagtgcctgccgttcgtctgggtgcgaaagttctggaatccctgcgc
gaccgcaacggtatcgacacggcaaaggtcgatgacattattttcggctgcgtcgacccg
gtcggtgaagctggtgcggtcatcccgcggtcgtcagcttttgaagccggttacgacttc
aaggcgccgggcatccagatttcgcgtttctgcgcctcgggcctcgatgcggtcaatctg
gcagcagccaaggtcgccttcggttccgacgatctggtgattgcaggcggcgtggaaagc
atgtcgcgtgtcggcatgggcatgtcgggcggtgcctggtacatggacccatcggtcggc
ttccccggctatttcatgccgcagggtgtttccgccgacttgatcgccacgaaatatggc
ttcagccgcgatgacgtcgatgcctatgccgtcgaaagccagaagcgtgccgccaagtcg
tgggaaaagggctatttcaagaactcggtcatttcgatcaaggaccagaatggcctgacc
attctcgatcatgacgagcatatgcgcccgacgaccgatatgcaggctctgggccagctc
aatccgtcctttgtgatgccgggcgaaatgggcggcttcaatgcggtcggcattcaggcc
cacccggaaatcgaaaccgtcaatcacgtccaccatgccggtaactcgtcgggcatcgtc
gatggtgcggctggcgttctggttggctccaggaaggctggcaaggccttcgacatcaag
ccgcgtgcgcgcattcgtgcttttgccaacatcggttccgaaccggcgctcatgctgacc
ggtccggtcgatgtgacggagaagcttctcaagcaggcgaagatgaaaatctcggacatc
gacctgtttgagctgaacgaagccttcgcggccgttgttctgcgctacatgcaggccttc
gacattccgcacgacaagatgaacgtcaatggcggtgccattgccatgggccatccgctc
ggtgcaaccggcgctatgatcctcggtacggtgctggatgaactggaacgccgcgatctc
aacaccgcactggtgaccttgtgcatcggtgccggcatgggcacggcgacaatcatcgag
cgcgtttaa

DBGET integrated database retrieval system