KEGG   Ochrobactrum anthropi OAB: DR92_681Help
Entry
DR92_681          CDS       T03251                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
oah00071  Fatty acid degradation
oah00072  Synthesis and degradation of ketone bodies
oah00280  Valine, leucine and isoleucine degradation
oah00310  Lysine degradation
oah00362  Benzoate degradation
oah00380  Tryptophan metabolism
oah00620  Pyruvate metabolism
oah00630  Glyoxylate and dicarboxylate metabolism
oah00640  Propanoate metabolism
oah00650  Butanoate metabolism
oah00900  Terpenoid backbone biosynthesis
oah01100  Metabolic pathways
oah01110  Biosynthesis of secondary metabolites
oah01120  Microbial metabolism in diverse environments
oah01130  Biosynthesis of antibiotics
oah01200  Carbon metabolism
oah01212  Fatty acid metabolism
oah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oah00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR92_681 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    DR92_681 (phbA)
   00640 Propanoate metabolism
    DR92_681 (phbA)
   00650 Butanoate metabolism
    DR92_681 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    DR92_681 (phbA)
   00072 Synthesis and degradation of ketone bodies
    DR92_681 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR92_681 (phbA)
   00310 Lysine degradation
    DR92_681 (phbA)
   00380 Tryptophan metabolism
    DR92_681 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR92_681 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR92_681 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DR92_681 (phbA)
Enzymes [BR:oah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR92_681 (phbA)
Exosome [BR:oah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR92_681 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIK45102
Position
1:716266..717450
Genome map
AA seq 394 aa AA seqDB search
MSDQKAIVIASAARTAVGAFNGAFANIPAHELGATVIKGALERAGVAATDVDEVILGQVL
TAGEGQNPARQAAMDAGCPKETTAFSINQLCGSGLRAVALGMQQILSGDAKIIVAGGQES
MSMAPHCAHLRSGVKMGDFKMVDTMLKDGLIDAFHGYHMGITAENIASQWQLTRADQDEF
ALASQQKAEAAQNAGRFEDEIVPFTVKGRKGDIVISADEYIRPGTTIEALTKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDADEATKRGVKPLARIVSWATAGVDPSIMGTGPIPATKK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPHIVNVNGGAIAIGHPIGASGARVL
TTLLYEMQRRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccagaaagccatcgtcattgccagcgcggcgcgtaccgcagtgggcgctttc
aacggtgcgtttgccaatatccccgcacatgaattgggcgcgacggttatcaaaggagcg
ctggaacgcgccggtgtggcggcgacggatgtggacgaggttattctcggacaggtgttg
acggcaggcgagggccagaaccctgcgcggcaggcggcgatggatgccggttgcccgaaa
gagacgacagccttctcgatcaaccagctatgcggttccggtttgcgagcggttgcgctc
ggcatgcagcagattctttccggcgatgccaagatcatcgtggcaggcggtcaggaatcc
atgtccatggcgccgcattgcgcgcatttacggtccggcgtgaagatgggcgacttcaag
atggtcgataccatgctgaaggacggcctgattgatgcctttcatggctatcatatgggg
atcactgccgagaatatcgccagccagtggcagttgacccgcgccgatcaggacgagttc
gcacttgcttcccagcagaaggcagaggcggcacagaatgcgggcaggttcgaggatgaa
attgttccgttcactgtaaagggtcgcaagggcgatatcgtcatttcggcggatgaatat
atccgtcccggcacgacgattgaggcattgaccaagttgaagcccgctttcgacaaggag
gggacggttactgcaggcaacgcatccgggattaacgatggtgctgcggctgtcgtgctg
atggatgcggatgaagccaccaagcgtggtgtgaagccgcttgcgcgcatcgtttcctgg
gcaacggctggcgtcgatccttcgatcatgggaacaggcccgattccggcgacgaagaag
gcgctggaaaaggcaggctggagcgtcggcgatctcgatctggtcgaagccaacgaagcc
tttgcagcacagtcctgtgctgttgtgcgtgatcttggtctcaacccccatatcgtcaac
gtcaatggcggagcaatcgcgatcggtcatccgatcggcgcatcaggcgcacgcgttctg
acgacgctgctttacgaaatgcagcgccgcgatgccaagcgcggtctggcgacactttgc
atcggcggcggcatgggcgttgccttgtgcgtcgagcgcgactga

DBGET integrated database retrieval system