KEGG   Ochrobactrum anthropi: Oant_0023Help
Entry
Oant_0023         CDS       T00568                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
oan  Ochrobactrum anthropi
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:oan03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:23974..24579
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRIC
SCCGNVDTSDPCTICTDERRDPTTLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLDGI
GPDDLNIKGLVERVSTGEIKEVILAVNATVEGQTTAHYITDQLSSFDVRVTRLAHGVPVG
GELDYLDEGTLAAALRARTTL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgaatagccggtcctgaaatcgaacgtctcatccagcttctggcccgtgtg
ccggggcttgggccgcgttcggcccgtcgtgcggcgctgcatctcatcaagaagaaagaa
gcgcttctggtgccgcttggtggcgccatgcaggaagctgccgaaaaggtgcgcatctgt
tcttgttgcggcaatgtcgatacgtccgatccatgcacgatctgcaccgatgaacgccgc
gatccgacgaccctcatcgtggtggaagatgtttccgatctctgggcgctggaacgggcg
ggcacgatgaatgtgcgctatcacgttctcggcggtcgcctgtcgccgctcgatggcatc
ggcccggacgatctcaacatcaagggactggtggaacgggtttccacgggtgagatcaag
gaagtgattctcgcggtcaacgctaccgtcgaaggccagaccacggcgcattacatcacc
gaccagttatcgagcttcgacgttcgtgtcacgcggcttgcccatggcgtcccggtcggc
ggcgagcttgattatctggatgaaggcacgcttgctgccgccttgcgggcaagaaccacc
ctttag

DBGET integrated database retrieval system