KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0272Help
Entry
Oant_0272         CDS       T00568                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00010  Glycolysis / Gluconeogenesis
oan00071  Fatty acid degradation
oan00350  Tyrosine metabolism
oan00625  Chloroalkane and chloroalkene degradation
oan00626  Naphthalene degradation
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oant_0272
  Lipid metabolism
   00071 Fatty acid degradation
    Oant_0272
  Amino acid metabolism
   00350 Tyrosine metabolism
    Oant_0272
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Oant_0272
   00626 Naphthalene degradation
    Oant_0272
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Oant_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ABS13003
JGI: Oant0272
UniProt: A6WVJ9
Position
1:281813..282847
Genome map
AA seq 344 aa AA seqDB search
MAKTMKAAVVRAFGKPLTIDEVPIPEPGPGQIQVAIHASGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGYVSAVGSGVKHVKEGDRVGVPWLYTACGHCRHCLGGWETLCEEQLNTGYSV
NGGFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGVGGL
GHMAVQYAKAMGLNVAAVDIDDRKLDLARKLGATITVNAKTHNDPAAYIKKETDGGAQGV
LVTAVSPIAFEQALGMVSRGGTVSLNGLPPGDFPLSIFNMVLNGVTVRGSIVGTRLDLQE
SLDFAGDGKVRATIRTEKLEDINSIFDDMRQGNIEGRVVVDLTQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacaatgaaagccgctgtggtgcgcgcattcggaaagccactgacaatcgac
gaagtgccaatacccgagcccggaccgggacagatacaggttgccatccatgcgtccggc
gtttgccataccgatctgcatgcagccgaaggcgactggccggtaaagcccaacccgcca
ttcattccggggcatgaaggcgtcggttatgtttcggctgtcggtagcggtgtcaaacac
gttaaggaaggcgaccgcgtcggcgttccatggctttataccgcatgtggccactgtcgt
cattgcctgggcggctgggaaacactctgcgaagagcagcttaatacaggctattcggtc
aatggcggctttgccgaatatgtcgttgccgatccgaatttcgttggtcacttgccgaag
aacattgatttcaacgaaatcgcgccggttctctgtgctggcgtaacggtttacaagggc
ctcaaggtaaccgacaccaagcccggtgactgggttgtgatttccggtgttggtggcctc
ggtcatatggcggtgcaatatgccaaggcaatggggcttaacgttgccgctgtcgacatc
gacgacagaaagcttgatctggcgcggaaacttggcgcgacgattaccgtcaatgccaaa
acgcataatgatccggcggcctatatcaaaaaagaaaccgatggcggtgcgcaaggcgtg
ctggttacggctgtttcgccgatcgcattcgaacaggccttgggcatggtatcgcgtggt
gggactgtatctctaaacggtctgccacccggtgacttcccgctctcaatattcaacatg
gtgctgaacggcgtcaccgtgcgcggctcaatcgtcggtacgcggctcgatctgcaggag
tcgctggattttgctggcgacggcaaggtccgcgctaccatccgcacggagaagctcgaa
gatatcaactccatcttcgatgatatgcgccaaggcaatattgaaggtcgcgtagtcgtg
gacctgactcaatag

DBGET integrated database retrieval system