KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0665Help
Entry
Oant_0665         CDS       T00568                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00260  Glycine, serine and threonine metabolism
oan00750  Vitamin B6 metabolism
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01230  Biosynthesis of amino acids
Module
oan_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oant_0665
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Oant_0665
Enzymes [BR:oan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Oant_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABS13390
JGI: Oant0665
UniProt: A6WWN6
Position
1:complement(695844..697085)
Genome map
AA seq 413 aa AA seqDB search
MMNRIAAYSCYRCGNEFPIDMPIDSRGCPSCLEIAPSNLKVLYRAPTPATSTVKGIARLP
SLWRYAERLPFDESSAVSLGEGLTPLLRSERIGAVIGVPNLFIKNEGYNPTWSHKDRFST
VAVTAAVEAGASVVATSSSGNAGASLAAYAARAGLECIVATIAGSAGPMLSQIQKYGAKI
VPFENKQERWPFLAKGVERYGWFATSPYRHPVVGSHPIGIEGYKTLAYEIIEQFNGKVPD
WCAFPVCYGDAIAGAWLGFHELMVDGLIARMPRLLAAEAHGSLATALETRSDQIPDMAAS
FNALAVSVGATRSTYQALKALRASNGTAIPVANDGLVAFQERIAASEGVFLELSSVMPLA
AIATARRRNIIRGDESAVAVVTASGLKDIDKSISEKPLPRFSNIEDALRHCDI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaggatcgcagcatattcctgctatcgatgcggtaacgaatttccgatcgac
atgccgatcgattcacgcggttgcccgtcatgtctggaaatcgctccttcaaatctgaaa
gtgctttatcgtgctcccactcctgcaacctcgaccgttaagggaatagcccggctgcct
tcgctctggcgttatgctgaaaggctcccttttgatgagagctccgctgtctctctgggc
gaaggtctgacaccactccttcgatcggaacggatcggtgcagtgatcggcgtgccaaat
cttttcatcaagaacgagggctacaatccaacttggtcacataaggatcggttctcaacc
gtcgcggtaacggccgcggtagaggcaggtgcatcagtcgtcgcaacgagttcaagcgga
aacgctggtgcatcgctcgccgcttatgcagcgcgcgcgggacttgagtgcatcgttgcg
accattgcgggttctgcggggcccatgctctcgcaaatccagaaatatggcgccaaaatc
gtacccttcgaaaacaagcaggagcgctggccgtttctcgccaagggtgtcgaacgctat
ggttggtttgcaacgtcgccttacagacatccagttgtcggcagccatccgatcggcatc
gaggggtacaaaaccctcgcctacgaaataatcgaacagttcaatgggaaagtgccggac
tggtgcgcgtttccggtctgctatggcgacgcgatcgcgggcgcctggctcggatttcac
gagttgatggtagacggattgatcgcccggatgccgcgcctgcttgcggcggaagcgcat
ggctctctcgccacagcgcttgagactcgaagcgaccagatacccgacatggccgcttcg
ttcaatgcgctcgccgtttcggttggagcgacaagaagcacataccaggccctcaaggcg
ctacgcgcttccaacggcaccgccattcccgtcgccaatgacggtctggtcgcctttcaa
gagcgaattgccgcgagcgaaggcgtatttttggagctttcttccgtgatgccgctcgct
gctatcgcgacagcacgacgtcgaaacataatccgcggagatgaaagcgctgtcgcggtt
gtcacggcttctggtctgaaggacatcgacaaatccatttcggaaaagcctctcccgcgc
ttcagcaatatcgaagacgccctcaggcattgcgacatctag

DBGET integrated database retrieval system