KEGG   Ochrobactrum anthropi: Oant_0716Help
Entry
Oant_0716         CDS       T00568                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
oan  Ochrobactrum anthropi
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:oan03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(744930..745838)
Genome map
AA seq 302 aa AA seqDB search
MALVQDQFSMPELPEVETVRRGLQPVMEGATVSQVEQRRPDLRFPFPDHFVERLSGRRIS
ALGRRAKYLTIHLDDGLSVISHLGMSGSFRIETDDDGGTPGEFHHERSKLSAHDHVVFHL
LRADGAPARIVYNDPRRFGFMLFAEEGTLDSHPLLASLGIEPTGNLLSGTILAELFKGRR
TPLKAALLDQRLIAGLGNIYVCEALWRSHLSPMQTAGSVAQNPAIMEQLAADIRTVIAEA
IAAGGSTLKDYIQADGALGYFQHSFSVYGREGEPCKNPACNGIVERAVQSGRSTFFCASC
QQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgttcaggatcagttttctatgcccgaattgccagaagtcgaaacggttcgc
cgtggtctgcagcccgtcatggagggcgcgaccgtcagccaagtcgaacaacgacgcccg
gacttgcgctttccctttcccgaccactttgtcgaacggctttccggtcggcgcatttcg
gcgcttggacgtcgcgcgaaatatctgacgatccatctcgatgacggcctatccgtcatc
agccatcttggcatgtcgggttcgtttcgcatcgagactgatgatgacggcggcacgccc
ggcgaattccatcatgagcgctccaagctgagtgcgcatgaccatgtcgtgtttcatctt
ctgcgggccgatggcgctccggcccgtatcgtctacaacgatccgcgtcgcttcggcttc
atgctttttgcggaagaaggcacgctcgatagtcacccgctgctggcaagcctcggcata
gagccgacaggcaatctgctctcgggcaccattctggccgaactcttcaaggggcgtcgg
acgccgctcaaggcggcgctgctcgatcagcggctgatagctggtcttggtaatatctat
gtttgcgaggcgctctggcgtagccacctgtcgcccatgcagacagccgggtctgttgcg
cagaatcccgcaatcatggagcaattggctgccgatatccgcacagtgatcgcggaagcc
attgccgcaggcggttcaaccctcaaggactatattcaggcagatggcgcgcttggctat
ttccaacactccttctccgtctatgggcgcgagggcgagccatgcaaaaaccctgcctgc
aacggcattgtggaacgggcggtacagtcgggacgttcaacttttttctgtgcctcctgc
cagcaatga

DBGET integrated database retrieval system