KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0810Help
Entry
Oant_0810         CDS       T00568                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oant_0810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oant_0810
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oant_0810
Enzymes [BR:oan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oant_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:838665..839885
Genome map
AA seq 406 aa AA seqDB search
MNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQEAYETAKNDPEFKAELNALS
TYYAGRPSKLYYAEGLTKHLGGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQKPNVFRMKLLGAEVIPVSAGNGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGNEARQQILEQEGRLPDVIV
AAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLDGEEHCASMSAGRPGVLHGNRTYLLQ
NDDGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDDEALDAFQLCTRTEGIIPA
LESAHAIAQAVKMAPTMGKDQVMIVNLSGRGDKDVHTVGKLLGMDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaagccggttgcacccaattcctataagacaggccccgatgaagagggcatgttc
ggtattttcggcggacgcttcgtcgccgaaacgctgatgccgctgatccttgaattgcag
gaagcctatgaaacggcgaagaacgatcctgaattcaaagctgagctgaacgcgctttca
acctattatgccggtcgtccttccaagctctattatgccgaaggcctgaccaaacatttg
ggcggtgcgaaaatctacttcaagcgtgaagacctcaatcacaccggcagtcacaagatc
aacaattgcctcggccagattctgcttgccaaacgcatgggcaagacccgtatcatcgct
gaaaccggcgccggacagcatggtgtggcttcggccaccgttgccgcgcgtttcggcctg
ccctgcgtggtctatatgggcgcaaccgacgtcgaacgtcagaagccgaatgtgttccgc
atgaagctgcttggtgccgaagtgatcccggtttctgcaggcaacggcacgctcaaggac
gcgatgaacgaagccctgcgtgactgggtgacaaatgtcgaagacacctattacctgatc
ggtacggctgccggtccgcatccctatccggaactggtgcgcgacttccagtcggtgatc
ggcaacgaagcgcgccaacagattctggaacaggaaggacgcctgccggatgtgatcgtg
gcagcggtcggcggcggttccaatgccatcggtctgttccatccgttccttgacgacgcc
tcggtgaagatcgtcggtgtcgaagcgggcggacgcggtctcgacggtgaagaacattgc
gcttcaatgagcgcaggtcgtcccggcgttctgcatggcaaccgcacctacctcctccag
aacgatgacggtcagattctcgaaggtcattccgtttctgccggtctcgactatccgggc
gtcgggcctgaacattcatggctgaaagacagcgggcgcgtcgattatgtgccaatcctc
gatgatgaggcgctggatgcatttcagctttgcacccgcaccgaaggcatcatccctgcc
ctcgaatccgcacatgccatcgcgcaggctgtgaaaatggcaccgaccatgggcaaggat
caggtcatgatcgtcaatctgtccggtcgtggcgacaaggatgtccacacggtcggcaag
cttctcggcatggacatctga

DBGET integrated database retrieval system